SimulationCraft 902-01

for World of Warcraft 9.0.2.36639 Live (wow build level 36639)

Beta Release

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2020-10-25 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00
2020-09-20 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Table of Contents

Raid Summary

Additional Raid Information

Kyrian_Forgelite : 16465 dps, 4796 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16464.6 16464.6 23.4 / 0.142% 1480.6 / 9.0% 8.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
1989.7 1893.9 Mana 0.00% 49.4 100.0% 100%
Talents
Kyrian

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_Forgelite 16465
Arcane Barrage 5603 34.1% 55.5 5.42sec 30390 24383 Direct 277.1 5107 10197 6088 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 55.49 277.07 0.00 0.00 1.2464 0.0000 1686285.24 1686285.24 0.00% 24382.73 24382.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 223.65 171 280 5106.77 2082 30168 5098.28 4538 5676 1141753 1141753 0.00%
crit 19.28% 53.41 27 79 10196.82 4164 60336 10185.74 7545 13858 544532 544532 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [r]:55.49
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 623 3.8% 59.6 4.74sec 3140 0 Direct 298.0 527 1053 628 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 59.60 297.98 0.00 0.00 0.0000 0.0000 187142.11 187142.11 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 240.60 184 311 526.87 316 664 526.44 483 574 126746 126746 0.00%
crit 19.26% 57.38 29 89 1052.86 633 1329 1051.91 935 1174 60396 60396 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 7375 44.8% 148.9 1.99sec 14889 11983 Direct 744.4 2498 4990 2978 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 148.88 744.40 0.00 0.00 1.2425 0.0000 2216591.23 2216591.23 0.00% 11983.19 11983.19
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 600.75 457 748 2497.56 1958 5756 2496.63 2411 2583 1500020 1500020 0.00%
crit 19.30% 143.65 90 193 4989.91 3916 11512 4988.29 4554 5426 716571 716571 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [q]:148.87
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1391) 0.0% (8.4%) 12.8 24.11sec 32586 26151

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.83 0.00 0.00 0.00 1.2461 0.0000 0.00 0.00 0.00% 26151.15 26151.15

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [p]:12.84
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1391 8.4% 64.1 24.11sec 6527 0 Direct 64.1 5490 10927 6529 19.1%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 64.07 64.07 0.00 0.00 0.0000 0.0000 418209.22 418209.22 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.91% 51.84 34 71 5489.75 3869 8938 5488.27 5025 5924 284511 284511 0.00%
crit 19.09% 12.23 2 26 10927.16 7739 17876 10922.68 7739 14084 133698 133698 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (69) 0.0% (0.4%) 14.7 1.80sec 1392 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.70 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 69 0.4% 14.7 1.80sec 1392 0 Direct 14.7 1164 2327 1392 19.6%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.70 14.70 0.00 0.00 0.0000 0.0000 20453.23 20453.23 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.40% 11.82 4 20 1163.53 1164 1164 1163.53 1164 1164 13749 13749 0.00%
crit 19.60% 2.88 0 8 2327.06 2327 2327 2247.06 0 2327 6705 6705 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1776 20.0%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1777.39 1777.39 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.96% 0.80 0 1 1480.68 1481 1481 1183.96 0 1481 1184 1184 0.00%
crit 20.04% 0.20 0 1 2961.35 2961 2961 593.43 0 2961 593 593 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.1%) 1.0 0.00sec 5790 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 145  / 20 0.1% 90.0 1.29sec 64 49 Direct 90.0 54 108 64 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5789.72 5789.72 0.00% 49.16 49.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.71% 72.64 61 83 53.93 43 60 53.94 53 55 3918 3918 0.00%
crit 19.29% 17.36 7 29 107.82 86 120 107.83 96 118 1872 1872 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Radiant Spark 182 1.1% 9.3 33.95sec 5856 4597 Direct 9.3 2854 5683 3409 19.6%
Periodic 60.7 315 632 377 19.4% 6.1%

Stats Details: Radiant Spark

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.33 9.33 60.66 60.66 1.2739 1.5125 54662.92 54662.92 0.00% 527.46 4597.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.43% 7.51 3 11 2853.66 2693 5655 2859.67 2693 3434 21432 21432 0.00%
crit 19.57% 1.83 0 7 5683.48 5386 11310 4890.23 0 11310 10380 10380 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.57% 48.87 32 67 315.38 34 501 315.03 277 350 15406 15406 0.00%
crit 19.43% 11.79 3 25 631.56 68 1003 630.85 371 854 7444 7444 0.00%

Action Details: Radiant Spark

  • id:307443
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.760000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.082400
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:307443
  • name:Radiant Spark
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Conjure a radiant spark that causes {$s1=0 + 76.0%} Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes {$307454s1=10}% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells.

Action Priority List

    aoe
    [j]:4.56
  • if_expr:cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
    aoe
    [k]:3.83
  • if_expr:cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
    aoe
    [l]:0.98
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Touch of the Magi 0 (1182) 0.0% (7.2%) 6.0 54.58sec 59509 47377

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.96 0.00 0.00 0.00 1.2562 0.0000 0.00 0.00 0.00% 47377.19 47377.19

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [m]:5.99
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 1182 7.2% 6.0 54.43sec 59509 0 Direct 29.8 11925 0 11925 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.96 29.78 0.00 0.00 0.0000 0.0000 354949.92 354949.92 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 29.78 25 35 11924.64 85 57628 11929.09 9322 15728 354950 354950 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:32203.25
  • base_dd_max:32203.25
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
pet - bron 72 / 14
melee 72 0.1% 17.4 9.07sec 237 183 Direct 17.4 198 395 237 20.1%

Stats Details: Melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 17.40 17.40 0.00 0.00 1.2993 0.0000 4128.58 5897.26 29.99% 182.62 182.62
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.88% 13.90 5 18 197.58 176 247 197.66 176 247 2746 3923 29.99%
crit 20.12% 3.50 0 9 394.95 353 494 390.47 0 494 1382 1974 29.64%

Action Details: Melee

  • id:0
  • school:physical
  • range:5.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:none
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:1.00
Simple Action Stats Execute Interval
Kyrian_Forgelite
Arcane Power 2.8 131.10sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.80 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [n]:2.80
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 262.32sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.80 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [v]:1.80
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.0 168.50sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 5.96 0.00 4.2915 0.7217 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [s]:1.00
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [u]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 5.8 52.38sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.85 0.00 0.00 0.00 1.2552 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [o]:5.87
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.33sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.74 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [t]:2.75
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
pet - bron
Anima Cannon 7.6 22.55sec

Stats Details: Anima Cannon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.61 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Anima Cannon

  • id:332525
  • school:arcane
  • range:100.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:8.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:332525
  • name:Anima Cannon
  • school:arcane
  • tooltip:
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}

Action Priority List

    default
    [ ]:7.62
Vitalizing Bolt (goliath_support) 13.3 12.12sec

Stats Details: Goliath Support

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
heal 13.34 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Goliath Support

  • id:332526
  • school:arcane
  • range:100.0
  • travel_speed:20.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:4.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Forgelite_bron
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:332526
  • name:Vitalizing Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}

Action Priority List

    default
    [ ]:13.36
Smash 7.6 22.52sec

Stats Details: Smash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 7.56 0.00 0.00 0.00 2.1660 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Smash

  • id:341163
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:3.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:6.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Weapon

  • normalized:false
  • weapon_power_mod:0.166667
  • weapon_multiplier:0.00

Spelldata

  • id:341163
  • name:Smash
  • school:physical
  • tooltip:
  • description:Attacks the ground with a heavy smash, inflicting Arcane damage to all enemies in a cone in front of the caster.

Action Priority List

    default
    [ ]:7.62

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 56.2 175.5 5.3sec 1.3sec 3.9sec 72.14% 0.00% 25.8 (25.8) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.9s

Stack Uptimes

  • arcane_charge_1:18.71%
  • arcane_charge_2:15.99%
  • arcane_charge_3:16.06%
  • arcane_charge_4:21.38%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 131.6sec 131.6sec 14.6sec 13.58% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.4s / 138.9s
  • trigger_min/max:120.4s / 138.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:13.58%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 263.0sec 263.0sec 11.6sec 6.87% 23.30% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:241.0s / 272.0s
  • trigger_min/max:241.0s / 272.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:6.87%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bron's Call to Action 3.0 221.2 118.9sec 1.3sec 99.2sec 99.02% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_brons_call_to_action
  • max_stacks:89
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:109.2s / 134.1s
  • trigger_min/max:0.9s / 7.0s
  • trigger_pct:100.00%
  • duration_min/max:1.1s / 131.5s

Stack Uptimes

  • brons_call_to_action_1:1.44%
  • brons_call_to_action_2:1.26%
  • brons_call_to_action_3:1.29%
  • brons_call_to_action_4:1.35%
  • brons_call_to_action_5:1.20%
  • brons_call_to_action_6:1.58%
  • brons_call_to_action_7:1.16%
  • brons_call_to_action_8:1.15%
  • brons_call_to_action_9:1.14%
  • brons_call_to_action_10:1.14%
  • brons_call_to_action_11:1.14%
  • brons_call_to_action_12:1.14%
  • brons_call_to_action_13:1.22%
  • brons_call_to_action_14:1.26%
  • brons_call_to_action_15:1.12%
  • brons_call_to_action_16:1.13%
  • brons_call_to_action_17:1.16%
  • brons_call_to_action_18:1.28%
  • brons_call_to_action_19:1.74%
  • brons_call_to_action_20:1.30%
  • brons_call_to_action_21:1.12%
  • brons_call_to_action_22:1.11%
  • brons_call_to_action_23:1.08%
  • brons_call_to_action_24:1.07%
  • brons_call_to_action_25:1.12%
  • brons_call_to_action_26:1.07%
  • brons_call_to_action_27:1.06%
  • brons_call_to_action_28:1.06%
  • brons_call_to_action_29:1.06%
  • brons_call_to_action_30:1.05%
  • brons_call_to_action_31:1.05%
  • brons_call_to_action_32:1.39%
  • brons_call_to_action_33:1.19%
  • brons_call_to_action_34:1.05%
  • brons_call_to_action_35:1.05%
  • brons_call_to_action_36:1.07%
  • brons_call_to_action_37:1.11%
  • brons_call_to_action_38:1.06%
  • brons_call_to_action_39:1.02%
  • brons_call_to_action_40:1.03%
  • brons_call_to_action_41:1.11%
  • brons_call_to_action_42:1.37%
  • brons_call_to_action_43:1.17%
  • brons_call_to_action_44:1.13%
  • brons_call_to_action_45:1.13%
  • brons_call_to_action_46:1.10%
  • brons_call_to_action_47:1.08%
  • brons_call_to_action_48:1.11%
  • brons_call_to_action_49:1.07%
  • brons_call_to_action_50:1.06%
  • brons_call_to_action_51:1.06%
  • brons_call_to_action_52:1.06%
  • brons_call_to_action_53:1.13%
  • brons_call_to_action_54:1.05%
  • brons_call_to_action_55:1.05%
  • brons_call_to_action_56:1.03%
  • brons_call_to_action_57:1.04%
  • brons_call_to_action_58:1.05%
  • brons_call_to_action_59:1.51%
  • brons_call_to_action_60:1.14%
  • brons_call_to_action_61:1.03%
  • brons_call_to_action_62:1.05%
  • brons_call_to_action_63:1.01%
  • brons_call_to_action_64:1.01%
  • brons_call_to_action_65:1.23%
  • brons_call_to_action_66:0.99%
  • brons_call_to_action_67:1.01%
  • brons_call_to_action_68:1.03%
  • brons_call_to_action_69:0.98%
  • brons_call_to_action_70:1.00%
  • brons_call_to_action_71:1.04%
  • brons_call_to_action_72:1.00%
  • brons_call_to_action_73:0.97%
  • brons_call_to_action_74:1.09%
  • brons_call_to_action_75:1.00%
  • brons_call_to_action_76:1.12%
  • brons_call_to_action_77:1.05%
  • brons_call_to_action_78:0.93%
  • brons_call_to_action_79:1.09%
  • brons_call_to_action_80:0.92%
  • brons_call_to_action_81:0.92%
  • brons_call_to_action_82:1.33%
  • brons_call_to_action_83:0.98%
  • brons_call_to_action_84:1.03%
  • brons_call_to_action_85:0.92%
  • brons_call_to_action_86:0.89%
  • brons_call_to_action_87:0.90%
  • brons_call_to_action_88:1.09%
  • brons_call_to_action_89:0.99%

Spelldata

  • id:332514
  • name:Bron's Call to Action
  • tooltip:Bron arrives in ${{$332514u=89}+1-$w1} damaging or healing spells or abilities.
  • description:{$@spelldesc333950=After using ${{$332514u=89}+1} damaging or healing spells and abilities, your next spell or ability summons Bron, who knocks enemies back on arrival and then attacks and heals your targets for {$333961d=30 seconds}.}
  • max_stacks:89
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 24.0 0.2 12.1sec 12.0sec 2.1sec 16.59% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.35%
  • clearcasting_2:0.25%
  • clearcasting_3:0.05%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 1.0 0.0 175.6sec 175.6sec 4.3sec 1.44% 0.00% 4.0 (4.0) 0.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:114.1s / 246.0s
  • trigger_min/max:114.1s / 246.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 4.3s

Stack Uptimes

  • evocation_1:1.44%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.43% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.43%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.6 0.0 36.2sec 36.2sec 11.8sec 33.80% 0.00% 0.0 (0.0) 8.3

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:15.7s / 55.3s
  • trigger_min/max:15.7s / 55.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • rune_of_power_1:33.80%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.45% 0.82% 6.47% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 300.7s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.660120.091239.937
Evocation169.50124.105330.048226.355143.748358.738
Rune of Power8.1091.13924.69548.89731.83877.485
Touch of the Magi7.0091.14123.37643.58430.53476.178
Arcane Power8.2590.37418.93223.7042.71834.279
Arcane Barrage2.9200.0039.585163.273129.258196.981
Arcane Orb4.0430.01811.79352.27040.70273.088
Radiant Spark2.2660.00022.27721.7219.69258.622

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_Forgelite
mana_regen Mana 625.95 369428.70 64.88% 590.19 10994.69 2.89%
Evocation Mana 47.70 48037.52 8.44% 1007.07 0.00 0.00%
Mana Gem Mana 2.75 17405.69 3.06% 6337.14 0.00 0.00%
Arcane Barrage Mana 55.49 134505.74 23.62% 2424.12 6144.51 4.37%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1893.85 1989.73 17099.0 34543.9 1777.7 63371.4
Usage Type Count Total Avg RPE APR
Kyrian_Forgelite
arcane_explosion Mana 148.9 567207.4 3810.2 3809.9 3.9
arcane_orb Mana 12.8 5741.5 447.3 447.4 72.8
radiant_spark Mana 9.3 9208.4 986.0 986.4 5.9
touch_of_the_magi Mana 6.0 14913.0 2500.0 2500.2 23.8

Statistics & Data Analysis

Fight Length
Kyrian_Forgelite Fight Length
Count 1018
Mean 300.66
Minimum 240.09
Maximum 359.94
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
Kyrian_Forgelite Damage Per Second
Count 1018
Mean 16464.64
Minimum 15370.67
Maximum 17648.84
Spread ( max - min ) 2278.17
Range [ ( max - min ) / 2 * 100% ] 6.92%
Standard Deviation 381.3822
5th Percentile 15852.39
95th Percentile 17102.86
( 95th Percentile - 5th Percentile ) 1250.47
Mean Distribution
Standard Deviation 11.9533
95.00% Confidence Interval ( 16441.21 - 16488.07 )
Normalized 95.00% Confidence Interval ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 21
0.1% Error 2062
0.1 Scale Factor Error with Delta=300 1242
0.05 Scale Factor Error with Delta=300 4967
0.01 Scale Factor Error with Delta=300 124167
Priority Target DPS
Kyrian_Forgelite Priority Target Damage Per Second
Count 1018
Mean 4796.04
Minimum 4382.83
Maximum 5379.93
Spread ( max - min ) 997.10
Range [ ( max - min ) / 2 * 100% ] 10.39%
Standard Deviation 169.8617
5th Percentile 4526.18
95th Percentile 5083.12
( 95th Percentile - 5th Percentile ) 556.95
Mean Distribution
Standard Deviation 5.3238
95.00% Confidence Interval ( 4785.61 - 4806.48 )
Normalized 95.00% Confidence Interval ( 99.78% - 100.22% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4819
0.1 Scale Factor Error with Delta=300 247
0.05 Scale Factor Error with Delta=300 986
0.01 Scale Factor Error with Delta=300 24631
DPS(e)
Kyrian_Forgelite Damage Per Second (Effective)
Count 1018
Mean 16464.64
Minimum 15370.67
Maximum 17648.84
Spread ( max - min ) 2278.17
Range [ ( max - min ) / 2 * 100% ] 6.92%
Damage
Kyrian_Forgelite Damage
Count 1018
Mean 4940071.28
Minimum 3828629.18
Maximum 5972334.53
Spread ( max - min ) 2143705.34
Range [ ( max - min ) / 2 * 100% ] 21.70%
DTPS
Kyrian_Forgelite Damage Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_Forgelite Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_Forgelite Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_Forgelite Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_Forgelite Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_Forgelite Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_ForgeliteTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_Forgelite Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
j 4.56 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
k 3.83 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
l 0.98 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
m 5.99 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
n 2.80 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
o 5.87 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
p 12.84 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
q 148.87 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
r 55.49 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
s 1.00 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
t 2.75 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
u 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
v 1.80 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYkmnuvrprqqqqrqqqqrqqqqorqqqtqrprqqqqrjqqqqrqqqqrqqqqrprqqqqrqqqqrkmorprqqqqrqqqqrqqqqrprqjqqqrqqqqrqqqqrmorprqqqqrqqqqlnrqqqqtrprqqqqrqqqqrqqqqrkmorprqqqqrqqqqrqqqqrprqjqqsqrqqqqrmorprqqqqrqjqqqrqqqqrprqqqqrqqqqrqqqqtrkmnvrprqqqqrqqqqo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Kyrian_Forgelite 63371.4/63371: 100% mana
Pre precombat R food Kyrian_Forgelite 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe k radiant_spark Fluffy_Pillow 62371.4/63371: 98% mana
0:01.307 aoe m touch_of_the_magi Fluffy_Pillow 62377.8/63371: 98% mana bloodlust
0:02.313 aoe n arcane_power Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4)
0:02.313 shared_cds u potion Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:02.313 shared_cds v berserking Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.313 aoe r arcane_barrage Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.227 aoe p arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.142 aoe r arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.057 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.972 aoe q arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.886 aoe q arcane_explosion Fluffy_Pillow 60689.6/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.802 aoe q arcane_explosion Fluffy_Pillow 59350.5/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.717 aoe r arcane_barrage Fluffy_Pillow 58010.2/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.632 aoe q arcane_explosion Fluffy_Pillow 61704.8/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.547 aoe q arcane_explosion Fluffy_Pillow 60364.5/63371: 95% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.463 aoe q arcane_explosion Fluffy_Pillow 59025.4/63371: 93% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.378 aoe q arcane_explosion Fluffy_Pillow 57685.1/63371: 91% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.294 aoe r arcane_barrage Fluffy_Pillow 56346.1/63371: 89% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.209 aoe q arcane_explosion Fluffy_Pillow 60040.6/63371: 95% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:15.126 aoe q arcane_explosion Fluffy_Pillow 58702.9/63371: 93% mana bloodlust, arcane_charge, arcane_power, potion_of_deathly_fixation
0:16.135 aoe q arcane_explosion Fluffy_Pillow 57481.7/63371: 91% mana bloodlust, arcane_charge(2), arcane_power, clearcasting, potion_of_deathly_fixation
0:17.141 aoe q arcane_explosion Fluffy_Pillow 58756.7/63371: 93% mana bloodlust, arcane_charge(3), arcane_power, potion_of_deathly_fixation
0:18.148 aoe o rune_of_power Fluffy_Pillow 57533.1/63371: 91% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:19.155 aoe r arcane_barrage Fluffy_Pillow 58809.4/63371: 93% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:20.161 aoe q arcane_explosion Fluffy_Pillow 62619.2/63371: 99% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:21.166 aoe q arcane_explosion Fluffy_Pillow 58893.0/63371: 93% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:22.171 aoe q arcane_explosion Fluffy_Pillow 55166.8/63371: 87% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:23.177 shared_cds t use_mana_gem Kyrian_Forgelite 51441.8/63371: 81% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.177 aoe q arcane_explosion Fluffy_Pillow 57778.9/63371: 91% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:24.184 aoe r arcane_barrage Fluffy_Pillow 54055.2/63371: 85% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:25.190 aoe p arcane_orb Fluffy_Pillow 57865.1/63371: 91% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:26.196 aoe r arcane_barrage Fluffy_Pillow 58640.2/63371: 93% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:27.203 aoe q arcane_explosion Fluffy_Pillow 62451.3/63371: 99% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:28.208 aoe q arcane_explosion Fluffy_Pillow 58725.1/63371: 93% mana bloodlust, arcane_charge, rune_of_power
0:29.216 aoe q arcane_explosion Fluffy_Pillow 55002.7/63371: 87% mana bloodlust, arcane_charge(2), rune_of_power
0:30.222 aoe q arcane_explosion Fluffy_Pillow 51277.7/63371: 81% mana bloodlust, arcane_charge(3), rune_of_power
0:31.229 aoe r arcane_barrage Fluffy_Pillow 47554.0/63371: 75% mana bloodlust, arcane_charge(4), clearcasting
0:32.235 aoe j radiant_spark Fluffy_Pillow 51363.9/63371: 81% mana bloodlust, clearcasting
0:33.242 aoe q arcane_explosion Fluffy_Pillow 51640.2/63371: 81% mana bloodlust, clearcasting
0:34.250 aoe q arcane_explosion Fluffy_Pillow 52917.8/63371: 84% mana bloodlust, arcane_charge
0:35.255 aoe q arcane_explosion Fluffy_Pillow 49191.5/63371: 78% mana bloodlust, arcane_charge(2)
0:36.262 aoe q arcane_explosion Fluffy_Pillow 45467.8/63371: 72% mana bloodlust, arcane_charge(3)
0:37.267 aoe r arcane_barrage Fluffy_Pillow 41741.6/63371: 66% mana bloodlust, arcane_charge(4)
0:38.274 aoe q arcane_explosion Fluffy_Pillow 45552.7/63371: 72% mana bloodlust
0:39.282 aoe q arcane_explosion Fluffy_Pillow 41830.3/63371: 66% mana bloodlust, arcane_charge
0:40.288 aoe q arcane_explosion Fluffy_Pillow 38105.3/63371: 60% mana bloodlust, arcane_charge(2), clearcasting
0:41.293 aoe q arcane_explosion Fluffy_Pillow 39379.1/63371: 62% mana arcane_charge(3)
0:42.600 aoe r arcane_barrage Fluffy_Pillow 36035.6/63371: 57% mana arcane_charge(4)
0:43.908 aoe q arcane_explosion Fluffy_Pillow 40228.3/63371: 63% mana
0:45.214 aoe q arcane_explosion Fluffy_Pillow 36883.6/63371: 58% mana arcane_charge
0:46.518 aoe q arcane_explosion Fluffy_Pillow 33536.3/63371: 53% mana arcane_charge(2)
0:47.826 aoe q arcane_explosion Fluffy_Pillow 30194.1/63371: 48% mana arcane_charge(3)
0:49.133 aoe r arcane_barrage Fluffy_Pillow 26850.6/63371: 42% mana arcane_charge(4)
0:50.440 aoe p arcane_orb Fluffy_Pillow 31042.0/63371: 49% mana
0:51.746 aoe r arcane_barrage Fluffy_Pillow 32197.3/63371: 51% mana arcane_charge(4)
0:53.053 aoe q arcane_explosion Fluffy_Pillow 36388.6/63371: 57% mana
0:54.359 aoe q arcane_explosion Fluffy_Pillow 33043.9/63371: 52% mana arcane_charge
0:55.667 aoe q arcane_explosion Fluffy_Pillow 29701.7/63371: 47% mana arcane_charge(2), clearcasting
0:56.974 aoe q arcane_explosion Fluffy_Pillow 31358.2/63371: 49% mana arcane_charge(3)
0:58.281 aoe r arcane_barrage Fluffy_Pillow 28014.8/63371: 44% mana arcane_charge(4)
0:59.589 aoe q arcane_explosion Fluffy_Pillow 32207.4/63371: 51% mana
1:00.897 aoe q arcane_explosion Fluffy_Pillow 28865.2/63371: 46% mana arcane_charge
1:02.204 aoe q arcane_explosion Fluffy_Pillow 25521.7/63371: 40% mana arcane_charge(2)
1:03.511 aoe q arcane_explosion Fluffy_Pillow 22178.3/63371: 35% mana arcane_charge(3)
1:04.818 aoe r arcane_barrage Fluffy_Pillow 18834.8/63371: 30% mana arcane_charge(4)
1:06.123 aoe k radiant_spark Fluffy_Pillow 23023.7/63371: 36% mana
1:07.429 aoe m touch_of_the_magi Fluffy_Pillow 23678.9/63371: 37% mana
1:08.736 aoe o rune_of_power Fluffy_Pillow 22835.4/63371: 36% mana arcane_charge(4)
1:10.043 aoe r arcane_barrage Fluffy_Pillow 24492.0/63371: 39% mana arcane_charge(4), rune_of_power
1:11.349 aoe p arcane_orb Fluffy_Pillow 28682.1/63371: 45% mana rune_of_power
1:12.656 aoe r arcane_barrage Fluffy_Pillow 29838.6/63371: 47% mana arcane_charge(4), clearcasting, rune_of_power
1:13.964 aoe q arcane_explosion Fluffy_Pillow 34031.3/63371: 54% mana clearcasting, rune_of_power
1:15.270 aoe q arcane_explosion Fluffy_Pillow 35686.5/63371: 56% mana arcane_charge, rune_of_power
1:16.576 aoe q arcane_explosion Fluffy_Pillow 32341.8/63371: 51% mana arcane_charge(2), rune_of_power
1:17.882 aoe q arcane_explosion Fluffy_Pillow 28997.1/63371: 46% mana arcane_charge(3), clearcasting, rune_of_power
1:19.189 aoe r arcane_barrage Fluffy_Pillow 30653.6/63371: 48% mana arcane_charge(4), rune_of_power
1:20.495 aoe q arcane_explosion Fluffy_Pillow 34843.7/63371: 55% mana rune_of_power
1:21.802 aoe q arcane_explosion Fluffy_Pillow 31500.2/63371: 50% mana arcane_charge, rune_of_power
1:23.109 aoe q arcane_explosion Fluffy_Pillow 28156.8/63371: 44% mana arcane_charge(2)
1:24.415 aoe q arcane_explosion Fluffy_Pillow 24812.0/63371: 39% mana arcane_charge(3)
1:25.722 aoe r arcane_barrage Fluffy_Pillow 21468.6/63371: 34% mana arcane_charge(4)
1:27.027 aoe q arcane_explosion Fluffy_Pillow 25657.4/63371: 40% mana
1:28.335 aoe q arcane_explosion Fluffy_Pillow 22315.2/63371: 35% mana arcane_charge, clearcasting
1:29.641 aoe q arcane_explosion Fluffy_Pillow 23970.5/63371: 38% mana arcane_charge(2)
1:30.948 aoe q arcane_explosion Fluffy_Pillow 20627.0/63371: 33% mana arcane_charge(3)
1:32.254 aoe r arcane_barrage Fluffy_Pillow 17282.3/63371: 27% mana arcane_charge(4)
1:33.562 aoe p arcane_orb Fluffy_Pillow 21474.9/63371: 34% mana
1:34.868 aoe r arcane_barrage Fluffy_Pillow 22630.2/63371: 36% mana arcane_charge(4)
1:36.174 aoe q arcane_explosion Fluffy_Pillow 26820.3/63371: 42% mana
1:37.481 aoe j radiant_spark Fluffy_Pillow 23476.8/63371: 37% mana arcane_charge
1:38.788 aoe q arcane_explosion Fluffy_Pillow 24133.3/63371: 38% mana arcane_charge
1:40.095 aoe q arcane_explosion Fluffy_Pillow 20789.9/63371: 33% mana arcane_charge(2)
1:41.399 aoe q arcane_explosion Fluffy_Pillow 17442.6/63371: 28% mana arcane_charge(3), clearcasting
1:42.707 aoe r arcane_barrage Fluffy_Pillow 19100.4/63371: 30% mana arcane_charge(4)
1:44.012 aoe q arcane_explosion Fluffy_Pillow 23289.3/63371: 37% mana
1:45.318 aoe q arcane_explosion Fluffy_Pillow 19944.5/63371: 31% mana arcane_charge
1:46.626 aoe q arcane_explosion Fluffy_Pillow 16602.3/63371: 26% mana arcane_charge(2)
1:47.933 aoe q arcane_explosion Fluffy_Pillow 13258.8/63371: 21% mana arcane_charge(3), clearcasting
1:49.240 aoe r arcane_barrage Fluffy_Pillow 14915.4/63371: 24% mana arcane_charge(4)
1:50.547 aoe q arcane_explosion Fluffy_Pillow 19106.8/63371: 30% mana brons_call_to_action
1:51.853 aoe q arcane_explosion Fluffy_Pillow 15762.0/63371: 25% mana arcane_charge, brons_call_to_action(2)
1:53.159 aoe q arcane_explosion Fluffy_Pillow 12417.3/63371: 20% mana arcane_charge(2), brons_call_to_action(3)
1:54.465 aoe q arcane_explosion Fluffy_Pillow 9072.5/63371: 14% mana arcane_charge(3), brons_call_to_action(4)
1:55.771 aoe r arcane_barrage Fluffy_Pillow 5727.8/63371: 9% mana arcane_charge(4), brons_call_to_action(5)
1:57.077 aoe m touch_of_the_magi Fluffy_Pillow 9917.9/63371: 16% mana brons_call_to_action(6)
1:58.384 aoe o rune_of_power Fluffy_Pillow 9074.4/63371: 14% mana arcane_charge(4), brons_call_to_action(7)
1:59.692 aoe r arcane_barrage Fluffy_Pillow 10732.2/63371: 17% mana arcane_charge(4), rune_of_power, brons_call_to_action(8)
2:00.998 aoe p arcane_orb Fluffy_Pillow 14922.4/63371: 24% mana rune_of_power, brons_call_to_action(8)
2:02.304 aoe r arcane_barrage Fluffy_Pillow 16077.6/63371: 25% mana arcane_charge(4), rune_of_power, brons_call_to_action(9)
2:03.610 aoe q arcane_explosion Fluffy_Pillow 20267.7/63371: 32% mana rune_of_power, brons_call_to_action(10)
2:04.917 aoe q arcane_explosion Fluffy_Pillow 16924.3/63371: 27% mana arcane_charge, clearcasting, rune_of_power, brons_call_to_action(11)
2:06.224 aoe q arcane_explosion Fluffy_Pillow 18580.8/63371: 29% mana arcane_charge(2), rune_of_power, brons_call_to_action(12)
2:07.531 aoe q arcane_explosion Fluffy_Pillow 15237.3/63371: 24% mana arcane_charge(3), rune_of_power, brons_call_to_action(13)
2:08.840 aoe r arcane_barrage Fluffy_Pillow 11896.4/63371: 19% mana arcane_charge(4), rune_of_power, brons_call_to_action(14)
2:10.147 aoe q arcane_explosion Fluffy_Pillow 16087.8/63371: 25% mana rune_of_power, brons_call_to_action(15)
2:11.453 aoe q arcane_explosion Fluffy_Pillow 12743.0/63371: 20% mana arcane_charge, rune_of_power, brons_call_to_action(16)
2:12.760 aoe q arcane_explosion Fluffy_Pillow 9399.6/63371: 15% mana arcane_charge(2), brons_call_to_action(17)
2:14.067 aoe q arcane_explosion Fluffy_Pillow 6056.1/63371: 10% mana arcane_charge(3), brons_call_to_action(18)
2:15.374 aoe l radiant_spark Fluffy_Pillow 2712.6/63371: 4% mana arcane_charge(4), brons_call_to_action(19)
2:16.681 aoe n arcane_power Fluffy_Pillow 3369.2/63371: 5% mana arcane_charge(4), clearcasting, brons_call_to_action(20)
2:16.681 aoe r arcane_barrage Fluffy_Pillow 3369.2/63371: 5% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, brons_call_to_action(20)
2:17.988 aoe q arcane_explosion Fluffy_Pillow 7560.5/63371: 12% mana arcane_power, clearcasting, rune_of_power, brons_call_to_action(20)
2:19.297 aoe q arcane_explosion Fluffy_Pillow 9219.6/63371: 15% mana arcane_charge, arcane_power, rune_of_power, brons_call_to_action(21)
2:20.604 aoe q arcane_explosion Fluffy_Pillow 8376.1/63371: 13% mana arcane_charge(2), arcane_power, rune_of_power, brons_call_to_action(22)
2:21.911 aoe q arcane_explosion Fluffy_Pillow 7532.7/63371: 12% mana arcane_charge(3), arcane_power, rune_of_power, brons_call_to_action(23)
2:23.216 shared_cds t use_mana_gem Kyrian_Forgelite 6686.7/63371: 11% mana arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(24)
2:23.216 aoe r arcane_barrage Fluffy_Pillow 13023.8/63371: 21% mana arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(24)
2:24.522 aoe p arcane_orb Fluffy_Pillow 17213.9/63371: 27% mana arcane_power, rune_of_power, brons_call_to_action(25)
2:25.828 aoe r arcane_barrage Fluffy_Pillow 18619.2/63371: 29% mana arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(26)
2:27.135 aoe q arcane_explosion Fluffy_Pillow 22810.6/63371: 36% mana arcane_power, rune_of_power, brons_call_to_action(27)
2:28.440 aoe q arcane_explosion Fluffy_Pillow 21964.6/63371: 35% mana arcane_charge, arcane_power, clearcasting, rune_of_power, brons_call_to_action(28)
2:29.748 aoe q arcane_explosion Fluffy_Pillow 23622.4/63371: 37% mana arcane_charge(2), arcane_power, brons_call_to_action(29)
2:31.054 aoe q arcane_explosion Fluffy_Pillow 22777.6/63371: 36% mana arcane_charge(3), arcane_power, brons_call_to_action(30)
2:32.360 aoe r arcane_barrage Fluffy_Pillow 21932.9/63371: 35% mana arcane_charge(4), brons_call_to_action(31)
2:33.666 aoe q arcane_explosion Fluffy_Pillow 26123.0/63371: 41% mana brons_call_to_action(32)
2:34.973 aoe q arcane_explosion Fluffy_Pillow 22779.5/63371: 36% mana arcane_charge, brons_call_to_action(33)
2:36.280 aoe q arcane_explosion Fluffy_Pillow 19436.1/63371: 31% mana arcane_charge(2), brons_call_to_action(34)
2:37.584 aoe q arcane_explosion Fluffy_Pillow 16088.8/63371: 25% mana arcane_charge(3), brons_call_to_action(35)
2:38.891 aoe r arcane_barrage Fluffy_Pillow 12745.3/63371: 20% mana arcane_charge(4), clearcasting, brons_call_to_action(36)
2:40.197 aoe q arcane_explosion Fluffy_Pillow 16935.4/63371: 27% mana clearcasting, brons_call_to_action(37)
2:41.504 aoe q arcane_explosion Fluffy_Pillow 18592.0/63371: 29% mana arcane_charge, brons_call_to_action(38)
2:42.809 aoe q arcane_explosion Fluffy_Pillow 15246.0/63371: 24% mana arcane_charge(2), brons_call_to_action(39)
2:44.117 aoe q arcane_explosion Fluffy_Pillow 11903.8/63371: 19% mana arcane_charge(3), brons_call_to_action(40)
2:45.424 aoe r arcane_barrage Fluffy_Pillow 8560.3/63371: 14% mana arcane_charge(4), brons_call_to_action(41)
2:46.729 aoe k radiant_spark Fluffy_Pillow 12749.1/63371: 20% mana brons_call_to_action(42)
2:48.034 aoe m touch_of_the_magi Fluffy_Pillow 13403.1/63371: 21% mana brons_call_to_action(43)
2:49.341 aoe o rune_of_power Fluffy_Pillow 12559.7/63371: 20% mana arcane_charge(4), brons_call_to_action(44)
2:50.647 aoe r arcane_barrage Fluffy_Pillow 14214.9/63371: 22% mana arcane_charge(4), rune_of_power, brons_call_to_action(45)
2:51.953 aoe p arcane_orb Fluffy_Pillow 18405.0/63371: 29% mana rune_of_power, brons_call_to_action(45)
2:53.258 aoe r arcane_barrage Fluffy_Pillow 19559.0/63371: 31% mana arcane_charge(4), rune_of_power, brons_call_to_action(46)
2:54.564 aoe q arcane_explosion Fluffy_Pillow 23749.2/63371: 37% mana rune_of_power, brons_call_to_action(47)
2:55.870 aoe q arcane_explosion Fluffy_Pillow 20404.4/63371: 32% mana arcane_charge, rune_of_power, brons_call_to_action(48)
2:57.177 aoe q arcane_explosion Fluffy_Pillow 17060.9/63371: 27% mana arcane_charge(2), rune_of_power, brons_call_to_action(49)
2:58.483 aoe q arcane_explosion Fluffy_Pillow 13716.2/63371: 22% mana arcane_charge(3), rune_of_power, brons_call_to_action(50)
2:59.788 aoe r arcane_barrage Fluffy_Pillow 10370.2/63371: 16% mana arcane_charge(4), rune_of_power, brons_call_to_action(51)
3:01.096 aoe q arcane_explosion Fluffy_Pillow 14562.9/63371: 23% mana rune_of_power, brons_call_to_action(52)
3:02.401 aoe q arcane_explosion Fluffy_Pillow 11216.9/63371: 18% mana arcane_charge, rune_of_power, brons_call_to_action(53)
3:03.708 aoe q arcane_explosion Fluffy_Pillow 7873.4/63371: 12% mana arcane_charge(2), clearcasting, brons_call_to_action(54)
3:05.014 aoe q arcane_explosion Fluffy_Pillow 9528.6/63371: 15% mana arcane_charge(3), brons_call_to_action(55)
3:06.321 aoe r arcane_barrage Fluffy_Pillow 6185.2/63371: 10% mana arcane_charge(4), brons_call_to_action(56)
3:07.628 aoe q arcane_explosion Fluffy_Pillow 10376.6/63371: 16% mana brons_call_to_action(57)
3:08.935 aoe q arcane_explosion Fluffy_Pillow 7033.1/63371: 11% mana arcane_charge, clearcasting, brons_call_to_action(58)
3:10.241 aoe q arcane_explosion Fluffy_Pillow 8688.3/63371: 14% mana arcane_charge(2), brons_call_to_action(59)
3:11.547 aoe q arcane_explosion Fluffy_Pillow 5343.6/63371: 8% mana arcane_charge(3), brons_call_to_action(60)
3:12.853 aoe r arcane_barrage Fluffy_Pillow 1998.9/63371: 3% mana arcane_charge(4), brons_call_to_action(61)
3:14.159 aoe p arcane_orb Fluffy_Pillow 6189.0/63371: 10% mana brons_call_to_action(62)
3:15.465 aoe r arcane_barrage Fluffy_Pillow 7344.3/63371: 12% mana arcane_charge(4), brons_call_to_action(63)
3:16.771 aoe q arcane_explosion Fluffy_Pillow 11534.4/63371: 18% mana brons_call_to_action(64)
3:18.079 aoe j radiant_spark Fluffy_Pillow 8192.2/63371: 13% mana arcane_charge, brons_call_to_action(65)
3:19.386 aoe q arcane_explosion Fluffy_Pillow 8848.7/63371: 14% mana arcane_charge, brons_call_to_action(66)
3:20.693 aoe q arcane_explosion Fluffy_Pillow 5505.2/63371: 9% mana arcane_charge(2), brons_call_to_action(66)
3:22.000 aoe s evocation Kyrian_Forgelite 2161.8/63371: 3% mana arcane_charge(3), brons_call_to_action(67)
3:26.342 aoe q arcane_explosion Fluffy_Pillow 56003.9/63371: 88% mana arcane_charge(3), brons_call_to_action(67)
3:27.649 aoe r arcane_barrage Fluffy_Pillow 52660.4/63371: 83% mana arcane_charge(4), brons_call_to_action(68)
3:28.955 aoe q arcane_explosion Fluffy_Pillow 56850.5/63371: 90% mana brons_call_to_action(69)
3:30.261 aoe q arcane_explosion Fluffy_Pillow 53505.8/63371: 84% mana arcane_charge, brons_call_to_action(70)
3:31.569 aoe q arcane_explosion Fluffy_Pillow 50163.6/63371: 79% mana arcane_charge(2), brons_call_to_action(71)
3:32.875 aoe q arcane_explosion Fluffy_Pillow 46818.9/63371: 74% mana arcane_charge(3), brons_call_to_action(72)
3:34.183 aoe r arcane_barrage Fluffy_Pillow 43476.7/63371: 69% mana arcane_charge(4), brons_call_to_action(73)
3:35.491 aoe m touch_of_the_magi Fluffy_Pillow 47669.3/63371: 75% mana brons_call_to_action(74)
3:36.798 aoe o rune_of_power Fluffy_Pillow 46825.8/63371: 74% mana arcane_charge(4), brons_call_to_action(75)
3:38.105 aoe r arcane_barrage Fluffy_Pillow 48482.4/63371: 77% mana arcane_charge(4), rune_of_power, brons_call_to_action(76)
3:39.412 aoe p arcane_orb Fluffy_Pillow 52673.8/63371: 83% mana rune_of_power, brons_call_to_action(76)
3:40.719 aoe r arcane_barrage Fluffy_Pillow 53830.3/63371: 85% mana arcane_charge(4), rune_of_power, brons_call_to_action(77)
3:42.023 aoe q arcane_explosion Fluffy_Pillow 58017.9/63371: 92% mana rune_of_power, brons_call_to_action(78)
3:43.328 aoe q arcane_explosion Fluffy_Pillow 54671.9/63371: 86% mana arcane_charge, rune_of_power, brons_call_to_action(79)
3:44.634 aoe q arcane_explosion Fluffy_Pillow 51327.1/63371: 81% mana arcane_charge(2), rune_of_power, brons_call_to_action(80)
3:45.941 aoe q arcane_explosion Fluffy_Pillow 47983.6/63371: 76% mana arcane_charge(3), rune_of_power, brons_call_to_action(81)
3:47.246 aoe r arcane_barrage Fluffy_Pillow 44637.6/63371: 70% mana arcane_charge(4), clearcasting, rune_of_power, brons_call_to_action(82)
3:48.552 aoe q arcane_explosion Fluffy_Pillow 48827.8/63371: 77% mana clearcasting, rune_of_power, brons_call_to_action(83)
3:49.859 aoe j radiant_spark Fluffy_Pillow 50484.3/63371: 80% mana arcane_charge, rune_of_power, brons_call_to_action(84)
3:51.165 aoe q arcane_explosion Fluffy_Pillow 51139.6/63371: 81% mana arcane_charge, brons_call_to_action(85)
3:52.471 aoe q arcane_explosion Fluffy_Pillow 47794.8/63371: 75% mana arcane_charge(2), brons_call_to_action(85)
3:53.779 aoe q arcane_explosion Fluffy_Pillow 44452.6/63371: 70% mana arcane_charge(3), brons_call_to_action(86)
3:55.085 aoe r arcane_barrage Fluffy_Pillow 41107.9/63371: 65% mana arcane_charge(4), brons_call_to_action(87)
3:56.390 aoe q arcane_explosion Fluffy_Pillow 45296.7/63371: 71% mana brons_call_to_action(88)
3:57.696 aoe q arcane_explosion Fluffy_Pillow 41952.0/63371: 66% mana arcane_charge, brons_call_to_action(89)
3:59.002 aoe q arcane_explosion Fluffy_Pillow 38607.2/63371: 61% mana arcane_charge(2), clearcasting
4:00.309 aoe q arcane_explosion Fluffy_Pillow 40263.8/63371: 64% mana arcane_charge(3), brons_call_to_action
4:01.615 aoe r arcane_barrage Fluffy_Pillow 36919.0/63371: 58% mana arcane_charge(4), clearcasting, brons_call_to_action(2)
4:02.920 aoe p arcane_orb Fluffy_Pillow 41107.9/63371: 65% mana clearcasting, brons_call_to_action(3)
4:04.225 aoe r arcane_barrage Fluffy_Pillow 42261.9/63371: 67% mana arcane_charge(4), clearcasting, brons_call_to_action(4)
4:05.531 aoe q arcane_explosion Fluffy_Pillow 46452.0/63371: 73% mana clearcasting, brons_call_to_action(5)
4:06.837 aoe q arcane_explosion Fluffy_Pillow 48107.3/63371: 76% mana arcane_charge, brons_call_to_action(6)
4:08.145 aoe q arcane_explosion Fluffy_Pillow 44765.1/63371: 71% mana arcane_charge(2), clearcasting, brons_call_to_action(7)
4:09.453 aoe q arcane_explosion Fluffy_Pillow 46422.9/63371: 73% mana arcane_charge(3), brons_call_to_action(8)
4:10.757 aoe r arcane_barrage Fluffy_Pillow 43075.6/63371: 68% mana arcane_charge(4), brons_call_to_action(9)
4:12.063 aoe q arcane_explosion Fluffy_Pillow 47265.7/63371: 75% mana brons_call_to_action(10)
4:13.370 aoe q arcane_explosion Fluffy_Pillow 43922.2/63371: 69% mana arcane_charge, clearcasting, brons_call_to_action(11)
4:14.677 aoe q arcane_explosion Fluffy_Pillow 45578.8/63371: 72% mana arcane_charge(2), brons_call_to_action(12)
4:15.983 aoe q arcane_explosion Fluffy_Pillow 42234.0/63371: 67% mana arcane_charge(3), brons_call_to_action(13)
4:17.288 aoe r arcane_barrage Fluffy_Pillow 38888.0/63371: 61% mana arcane_charge(4), clearcasting, brons_call_to_action(14)
4:18.594 aoe q arcane_explosion Fluffy_Pillow 43078.1/63371: 68% mana clearcasting, brons_call_to_action(15)
4:19.902 aoe q arcane_explosion Fluffy_Pillow 44735.9/63371: 71% mana arcane_charge, brons_call_to_action(16)
4:21.209 aoe q arcane_explosion Fluffy_Pillow 41392.5/63371: 65% mana arcane_charge(2), brons_call_to_action(17)
4:22.515 aoe q arcane_explosion Fluffy_Pillow 38047.7/63371: 60% mana arcane_charge(3), brons_call_to_action(18)
4:23.821 shared_cds t use_mana_gem Kyrian_Forgelite 34703.0/63371: 55% mana arcane_charge(4), clearcasting, brons_call_to_action(19)
4:23.821 aoe r arcane_barrage Fluffy_Pillow 41040.1/63371: 65% mana arcane_charge(4), clearcasting, brons_call_to_action(19)
4:25.125 aoe k radiant_spark Fluffy_Pillow 45227.7/63371: 71% mana clearcasting, brons_call_to_action(20)
4:26.431 aoe m touch_of_the_magi Fluffy_Pillow 45883.0/63371: 72% mana clearcasting, brons_call_to_action(21)
4:27.736 aoe n arcane_power Fluffy_Pillow 45037.0/63371: 71% mana arcane_charge(4), clearcasting, brons_call_to_action(22)
4:27.736 shared_cds v berserking Fluffy_Pillow 45037.0/63371: 71% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, brons_call_to_action(22)
4:27.736 aoe r arcane_barrage Fluffy_Pillow 45037.0/63371: 71% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, brons_call_to_action(22)
4:28.926 aoe p arcane_orb Fluffy_Pillow 49080.1/63371: 77% mana berserking, arcane_power, clearcasting, rune_of_power, brons_call_to_action(22)
4:30.116 aoe r arcane_barrage Fluffy_Pillow 50338.3/63371: 79% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, brons_call_to_action(23)
4:31.304 aoe q arcane_explosion Fluffy_Pillow 54378.9/63371: 86% mana berserking, arcane_power, clearcasting, rune_of_power, brons_call_to_action(24)
4:32.493 aoe q arcane_explosion Fluffy_Pillow 55885.8/63371: 88% mana berserking, arcane_charge, arcane_power, rune_of_power, brons_call_to_action(25)
4:33.682 aoe q arcane_explosion Fluffy_Pillow 54892.8/63371: 87% mana berserking, arcane_charge(2), arcane_power, rune_of_power, brons_call_to_action(26)
4:34.872 aoe q arcane_explosion Fluffy_Pillow 53901.1/63371: 85% mana berserking, arcane_charge(3), arcane_power, rune_of_power, brons_call_to_action(27)
4:36.060 aoe r arcane_barrage Fluffy_Pillow 52906.8/63371: 83% mana berserking, arcane_charge(4), arcane_power, rune_of_power, brons_call_to_action(28)
4:37.249 aoe q arcane_explosion Fluffy_Pillow 56948.6/63371: 90% mana berserking, arcane_power, rune_of_power, brons_call_to_action(29)
4:38.437 aoe q arcane_explosion Fluffy_Pillow 55954.3/63371: 88% mana berserking, arcane_charge, arcane_power, rune_of_power, brons_call_to_action(30)
4:39.626 aoe q arcane_explosion Fluffy_Pillow 54961.3/63371: 87% mana berserking, arcane_charge(2), arcane_power, rune_of_power, brons_call_to_action(31)
4:40.814 aoe q arcane_explosion Fluffy_Pillow 53967.0/63371: 85% mana arcane_charge(3), arcane_power, brons_call_to_action(32)
4:42.120 aoe o rune_of_power Fluffy_Pillow 53122.2/63371: 84% mana arcane_charge(4), arcane_power, brons_call_to_action(33)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Kyrian_Forgelite"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=kyrian
soulbind=333950//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Kyrian_Pelagos : 16696 dps, 4859 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16695.7 16695.7 24.7 / 0.148% 1590.6 / 9.5% 8.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
1996.3 1903.8 Mana 0.00% 49.5 100.0% 100%
Talents
Kyrian

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Kyrian_Pelagos 16696
Arcane Barrage 5667 34.0% 55.5 5.41sec 30713 24641 Direct 277.3 5153 10320 6153 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 55.52 277.27 0.00 0.00 1.2464 0.0000 1705182.55 1705182.55 0.00% 24641.01 24641.01
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 223.64 165 282 5152.99 2082 31635 5144.89 4509 5604 1152264 1152264 0.00%
crit 19.34% 53.63 29 81 10319.91 4164 65364 10290.29 7950 13981 552919 552919 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [r]:55.51
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 624 3.7% 59.6 4.71sec 3142 0 Direct 298.2 527 1053 629 19.4%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 59.63 298.16 0.00 0.00 0.0000 0.0000 187384.81 187384.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.61% 240.35 177 312 526.71 316 664 526.10 484 572 126545 126545 0.00%
crit 19.39% 57.80 32 88 1052.66 633 1329 1051.68 938 1217 60839 60839 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 7487 44.8% 149.0 1.98sec 15099 12152 Direct 745.1 2531 5057 3021 19.4%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 149.03 745.15 0.00 0.00 1.2425 0.0000 2250198.03 2250198.03 0.00% 12151.80 12151.80
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.62% 600.71 457 754 2530.96 1958 6227 2530.14 2432 2626 1520035 1520035 0.00%
crit 19.38% 144.44 98 192 5056.97 3916 12454 5054.86 4665 5539 730163 730163 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [q]:149.01
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1427) 0.0% (8.5%) 12.8 24.06sec 33445 26840

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 12.83 0.00 0.00 0.00 1.2461 0.0000 0.00 0.00 0.00% 26840.32 26840.32

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [p]:12.83
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1427 8.5% 64.0 24.07sec 6702 0 Direct 64.0 5616 11217 6703 19.4%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 64.02 64.02 0.00 0.00 0.0000 0.0000 429069.39 429069.39 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.59% 51.60 33 70 5616.16 3869 9669 5615.03 5139 6140 289683 289683 0.00%
crit 19.41% 12.43 3 26 11217.19 7739 19338 11217.99 8255 14833 139386 139386 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (69) 0.0% (0.4%) 14.7 1.75sec 1390 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 69 0.4% 14.7 1.75sec 1390 0 Direct 14.7 1164 2327 1390 19.5%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.75 14.75 0.00 0.00 0.0000 0.0000 20503.52 20503.52 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.52% 11.88 4 20 1163.53 1164 1164 1163.53 1164 1164 13817 13817 0.00%
crit 19.48% 2.87 0 10 2327.06 2327 2327 2231.05 0 2327 6686 6686 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1780 20.1%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1778.85 1778.85 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.86% 0.80 0 1 1480.68 1481 1481 1182.51 0 1481 1183 1183 0.00%
crit 20.14% 0.20 0 1 2961.35 2961 2961 596.34 0 2961 596 596 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (19) 0.0% (0.1%) 1.0 0.00sec 5777 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 144  / 19 0.1% 90.0 1.29sec 64 49 Direct 90.0 54 108 64 19.0%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5776.57 5776.57 0.00% 49.05 49.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.99% 72.89 59 83 53.93 43 60 53.93 53 55 3931 3931 0.00%
crit 19.01% 17.11 7 31 107.88 86 120 107.93 95 120 1846 1846 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Radiant Spark 182 1.1% 9.3 33.83sec 5855 4597 Direct 9.3 2857 5665 3409 19.6%
Periodic 60.7 316 630 377 19.3% 6.1%

Stats Details: Radiant Spark

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 9.34 9.34 60.70 60.70 1.2736 1.5133 54680.06 54680.06 0.00% 527.04 4597.28
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.35% 7.50 2 11 2856.75 2693 5655 2861.40 2693 3501 21431 21431 0.00%
crit 19.65% 1.83 0 7 5664.84 5386 11310 4951.00 0 11310 10397 10397 0.00%
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.66% 48.96 31 66 315.87 34 501 315.71 277 355 15462 15462 0.00%
crit 19.34% 11.74 2 23 629.88 68 1003 630.28 386 907 7390 7390 0.00%

Action Details: Radiant Spark

  • id:307443
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:30.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.760000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.082400
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:307443
  • name:Radiant Spark
  • school:arcane
  • tooltip:Suffering $w2 Arcane damage every $t2 sec.
  • description:Conjure a radiant spark that causes {$s1=0 + 76.0%} Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes {$307454s1=10}% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells.

Action Priority List

    aoe
    [j]:4.55
  • if_expr:cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
    aoe
    [k]:3.84
  • if_expr:cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
    aoe
    [l]:0.99
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Touch of the Magi 0 (1215) 0.0% (7.3%) 6.0 54.47sec 61223 48742

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.96 0.00 0.00 0.00 1.2562 0.0000 0.00 0.00 0.00% 48742.34 48742.34

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [m]:6.00
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 1215 7.3% 6.0 54.30sec 61223 0 Direct 29.7 12282 0 12282 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.96 29.74 0.00 0.00 0.0000 0.0000 364933.91 364933.91 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 29.74 20 35 12282.09 85 60879 12274.78 9356 15067 364934 364934 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:21442.51
  • base_dd_max:21442.51
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Kyrian_Pelagos
Arcane Power 2.8 131.77sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.79 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [n]:2.79
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 263.56sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.79 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [v]:1.79
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.9 167.06sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.94 0.00 5.61 0.00 4.3126 0.7223 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [s]:0.94
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [u]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 5.8 52.37sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.84 0.00 0.00 0.00 1.2551 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [o]:5.87
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.71sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Kyrian_Pelagos
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [t]:2.75
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 56.2 175.6 5.3sec 1.3sec 3.9sec 72.13% 0.00% 25.7 (25.8) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.9s

Stack Uptimes

  • arcane_charge_1:18.77%
  • arcane_charge_2:15.96%
  • arcane_charge_3:16.00%
  • arcane_charge_4:21.40%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 131.9sec 131.9sec 14.7sec 13.59% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.2s / 138.9s
  • trigger_min/max:120.2s / 138.9s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 15.0s

Stack Uptimes

  • arcane_power_1:13.59%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 263.4sec 263.4sec 11.7sec 6.87% 23.23% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:240.6s / 272.2s
  • trigger_min/max:240.6s / 272.2s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 12.0s

Stack Uptimes

  • berserking_1:6.87%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 23.6 0.2 12.3sec 12.2sec 2.1sec 16.27% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.03%
  • clearcasting_2:0.25%
  • clearcasting_3:0.03%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Combat Meditation 4.9 0.0 67.5sec 67.5sec 7.9sec 12.90% 0.00% 9.7 (9.7) 4.8

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_combat_meditation
  • max_stacks:1
  • base duration:10.00
  • duration modifier:0.50
  • base cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:extend
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:3.00

Stat Details

  • stat:mastery_rating
  • amount:350.00

Trigger Details

  • interval_min/max:62.7s / 88.0s
  • trigger_min/max:62.7s / 88.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • combat_meditation_1:12.90%

Spelldata

  • id:328908
  • name:Combat Meditation
  • tooltip:Mastery increased by $w.
  • description:{$@spelldesc328266=$?a137005[Shackle the Unworthy]?a212611[Elysian Decree]?a137009[Kindred Spirits]?a137014[Resonating Arrow]?a137018[Radiant Spark]?a137022[Weapons of Order]?a137026[Divine Toll]?a137030[Boon of the Ascended]?a137034[Echoing Reprimand]?a137038[Vesper Totem]?a137042[Scouring Tithe]?a137047[Spear of Bastion][Activating your Kyrian class ability] increases your Mastery by $328908m1 for ${{$328908d=10 seconds}*$<mod>}.1 sec and occasionally expels Sorrowful Memories. Walking through Sorrowful Memories extends this effect by ${$328913m2*$<mod>}.1 sec. $?a137018|?a137034[Combat Meditation may only occur once every {$345861d=60 seconds}.][]}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Evocation 0.9 0.0 169.4sec 169.4sec 4.3sec 1.35% 0.00% 3.7 (3.7) 0.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:119.3s / 244.7s
  • trigger_min/max:119.3s / 244.7s
  • trigger_pct:100.00%
  • duration_min/max:0.6s / 4.3s

Stack Uptimes

  • evocation_1:1.35%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.43% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.43%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.6 0.0 36.1sec 36.1sec 11.8sec 33.83% 0.00% 0.0 (0.0) 8.3

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.4s / 55.3s
  • trigger_min/max:14.4s / 55.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • rune_of_power_1:33.83%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.52% 0.82% 6.22% 0.8s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 300.7s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.660120.091239.937
Evocation173.36829.294330.203230.529143.737359.533
Rune of Power8.0541.13824.69448.52831.83181.188
Touch of the Magi6.9201.13623.38542.99430.52579.647
Arcane Power8.4590.22718.90824.1522.72634.474
Arcane Barrage2.9190.0029.586163.194129.326197.046
Arcane Orb4.0380.01711.79052.20740.09173.076
Radiant Spark2.2340.00022.28221.3959.69758.597

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Kyrian_Pelagos
mana_regen Mana 628.12 373141.45 65.18% 594.06 11939.19 3.10%
Evocation Mana 45.04 45397.48 7.93% 1008.01 0.00 0.00%
Mana Gem Mana 2.75 17831.17 3.11% 6482.92 0.00 0.00%
Arcane Barrage Mana 55.51 136076.20 23.77% 2451.18 6939.07 4.85%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1903.82 1996.35 18838.4 34528.7 327.4 63371.4
Usage Type Count Total Avg RPE APR
Kyrian_Pelagos
arcane_explosion Mana 149.0 569361.7 3820.8 3820.5 4.0
arcane_orb Mana 12.8 5738.4 447.2 447.3 74.8
radiant_spark Mana 9.3 9219.5 986.9 987.2 5.9
touch_of_the_magi Mana 6.0 14900.9 2500.0 2499.8 24.5

Statistics & Data Analysis

Fight Length
Kyrian_Pelagos Fight Length
Count 1018
Mean 300.66
Minimum 240.09
Maximum 359.94
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
Kyrian_Pelagos Damage Per Second
Count 1018
Mean 16695.65
Minimum 15395.57
Maximum 17954.06
Spread ( max - min ) 2558.50
Range [ ( max - min ) / 2 * 100% ] 7.66%
Standard Deviation 402.7655
5th Percentile 16062.61
95th Percentile 17370.78
( 95th Percentile - 5th Percentile ) 1308.16
Mean Distribution
Standard Deviation 12.6235
95.00% Confidence Interval ( 16670.91 - 16720.39 )
Normalized 95.00% Confidence Interval ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 23
0.1% Error 2236
0.1 Scale Factor Error with Delta=300 1385
0.05 Scale Factor Error with Delta=300 5540
0.01 Scale Factor Error with Delta=300 138481
Priority Target DPS
Kyrian_Pelagos Priority Target Damage Per Second
Count 1018
Mean 4858.61
Minimum 4321.02
Maximum 5424.99
Spread ( max - min ) 1103.97
Range [ ( max - min ) / 2 * 100% ] 11.36%
Standard Deviation 177.2216
5th Percentile 4572.97
95th Percentile 5165.42
( 95th Percentile - 5th Percentile ) 592.44
Mean Distribution
Standard Deviation 5.5545
95.00% Confidence Interval ( 4847.72 - 4869.49 )
Normalized 95.00% Confidence Interval ( 99.78% - 100.22% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 52
0.1% Error 5112
0.1 Scale Factor Error with Delta=300 269
0.05 Scale Factor Error with Delta=300 1073
0.01 Scale Factor Error with Delta=300 26812
DPS(e)
Kyrian_Pelagos Damage Per Second (Effective)
Count 1018
Mean 16695.65
Minimum 15395.57
Maximum 17954.06
Spread ( max - min ) 2558.50
Range [ ( max - min ) / 2 * 100% ] 7.66%
Damage
Kyrian_Pelagos Damage
Count 1018
Mean 5013731.11
Minimum 3897627.31
Maximum 6090997.38
Spread ( max - min ) 2193370.07
Range [ ( max - min ) / 2 * 100% ] 21.87%
DTPS
Kyrian_Pelagos Damage Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Kyrian_Pelagos Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Kyrian_Pelagos Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Kyrian_Pelagos Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Kyrian_Pelagos Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Kyrian_Pelagos Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Kyrian_PelagosTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Kyrian_Pelagos Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
j 4.55 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
k 3.84 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
l 0.99 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
m 6.00 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
n 2.79 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
o 5.87 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
p 12.83 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
q 149.01 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
r 55.51 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
s 0.94 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
t 2.75 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
u 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
v 1.79 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYkmnuvrprqqqqrqqqqrqqqqorqqqtqrprqqqqrjqqqqrqqqqrqqqqrprqqqqrqqqqrkmorprqqqqrqqqqrqqqqrprqjqqqrqqqqrqqqqrmorprqqqqrqqqqlnrqqqqtrprqqqqrqqqqrqqqqrkmorprqqqqrqqqqrqqqqrprqjqqqrqqqqrqqqqrmorprqqqqrjqqsqqrprqqqqrqqqqrqqqqtrkmnvrprqqqqrqqqqo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Kyrian_Pelagos 63371.4/63371: 100% mana
Pre precombat R food Kyrian_Pelagos 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe k radiant_spark Fluffy_Pillow 62371.4/63371: 98% mana
0:01.309 aoe m touch_of_the_magi Fluffy_Pillow 68286.5/69371: 98% mana bloodlust, combat_meditation
0:02.315 aoe n arcane_power Fluffy_Pillow 66877.0/69371: 96% mana bloodlust, arcane_charge(4), combat_meditation
0:02.315 shared_cds u potion Fluffy_Pillow 66877.0/69371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, combat_meditation
0:02.315 shared_cds v berserking Fluffy_Pillow 66877.0/69371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:02.315 aoe r arcane_barrage Fluffy_Pillow 66877.0/69371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:03.230 aoe p arcane_orb Fluffy_Pillow 69371.4/69371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:04.145 aoe r arcane_barrage Fluffy_Pillow 69371.4/69371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:05.060 aoe q arcane_explosion Fluffy_Pillow 69371.4/69371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:05.975 aoe q arcane_explosion Fluffy_Pillow 68140.9/69371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:06.890 aoe q arcane_explosion Fluffy_Pillow 66910.4/69371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:07.804 aoe q arcane_explosion Fluffy_Pillow 65678.5/69371: 95% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:08.718 aoe r arcane_barrage Fluffy_Pillow 64446.6/69371: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, combat_meditation, potion_of_deathly_fixation
0:09.631 aoe q arcane_explosion Fluffy_Pillow 62564.6/63371: 99% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.546 aoe q arcane_explosion Fluffy_Pillow 61224.3/63371: 97% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.461 aoe q arcane_explosion Fluffy_Pillow 59884.0/63371: 94% mana bloodlust, berserking, arcane_charge(2), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:12.376 aoe q arcane_explosion Fluffy_Pillow 61043.7/63371: 96% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.290 aoe r arcane_barrage Fluffy_Pillow 59702.1/63371: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.204 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:15.119 aoe q arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, arcane_charge, arcane_power, potion_of_deathly_fixation
0:16.124 aoe q arcane_explosion Fluffy_Pillow 60804.9/63371: 96% mana bloodlust, arcane_charge(2), arcane_power, potion_of_deathly_fixation
0:17.129 aoe q arcane_explosion Fluffy_Pillow 59578.7/63371: 94% mana bloodlust, arcane_charge(3), arcane_power, potion_of_deathly_fixation
0:18.136 aoe o rune_of_power Fluffy_Pillow 58355.0/63371: 92% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:19.143 aoe r arcane_barrage Fluffy_Pillow 59631.3/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:20.149 aoe q arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:21.156 aoe q arcane_explosion Fluffy_Pillow 59647.7/63371: 94% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:22.163 aoe q arcane_explosion Fluffy_Pillow 55924.0/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:23.169 shared_cds t use_mana_gem Kyrian_Pelagos 52199.1/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.169 aoe q arcane_explosion Fluffy_Pillow 58536.2/63371: 92% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:24.174 aoe r arcane_barrage Fluffy_Pillow 54810.0/63371: 86% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:25.179 aoe p arcane_orb Fluffy_Pillow 58618.6/63371: 93% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:26.185 aoe r arcane_barrage Fluffy_Pillow 59393.6/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:27.191 aoe q arcane_explosion Fluffy_Pillow 63203.5/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:28.199 aoe q arcane_explosion Fluffy_Pillow 59481.1/63371: 94% mana bloodlust, arcane_charge, rune_of_power
0:29.205 aoe q arcane_explosion Fluffy_Pillow 55756.1/63371: 88% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power
0:30.213 aoe q arcane_explosion Fluffy_Pillow 57033.7/63371: 90% mana bloodlust, arcane_charge(3), rune_of_power
0:31.220 aoe r arcane_barrage Fluffy_Pillow 53310.0/63371: 84% mana bloodlust, arcane_charge(4), clearcasting
0:32.225 aoe j radiant_spark Fluffy_Pillow 57118.6/63371: 90% mana bloodlust, clearcasting
0:33.230 aoe q arcane_explosion Fluffy_Pillow 57392.4/63371: 91% mana bloodlust, clearcasting
0:34.239 aoe q arcane_explosion Fluffy_Pillow 58671.2/63371: 93% mana bloodlust, arcane_charge
0:35.244 aoe q arcane_explosion Fluffy_Pillow 54945.0/63371: 87% mana bloodlust, arcane_charge(2)
0:36.252 aoe q arcane_explosion Fluffy_Pillow 51222.5/63371: 81% mana bloodlust, arcane_charge(3)
0:37.259 aoe r arcane_barrage Fluffy_Pillow 47498.8/63371: 75% mana bloodlust, arcane_charge(4)
0:38.267 aoe q arcane_explosion Fluffy_Pillow 51311.3/63371: 81% mana bloodlust
0:39.273 aoe q arcane_explosion Fluffy_Pillow 47586.3/63371: 75% mana bloodlust, arcane_charge
0:40.278 aoe q arcane_explosion Fluffy_Pillow 43860.1/63371: 69% mana bloodlust, arcane_charge(2)
0:41.283 aoe q arcane_explosion Fluffy_Pillow 40133.8/63371: 63% mana arcane_charge(3)
0:42.589 aoe r arcane_barrage Fluffy_Pillow 36789.1/63371: 58% mana arcane_charge(4), clearcasting
0:43.894 aoe q arcane_explosion Fluffy_Pillow 40977.9/63371: 65% mana clearcasting
0:45.201 aoe q arcane_explosion Fluffy_Pillow 42634.5/63371: 67% mana arcane_charge
0:46.507 aoe q arcane_explosion Fluffy_Pillow 39289.7/63371: 62% mana arcane_charge(2)
0:47.815 aoe q arcane_explosion Fluffy_Pillow 35947.5/63371: 57% mana arcane_charge(3), clearcasting
0:49.121 aoe r arcane_barrage Fluffy_Pillow 37602.8/63371: 59% mana arcane_charge(4)
0:50.429 aoe p arcane_orb Fluffy_Pillow 41795.5/63371: 66% mana
0:51.737 aoe r arcane_barrage Fluffy_Pillow 42953.2/63371: 68% mana arcane_charge(4)
0:53.044 aoe q arcane_explosion Fluffy_Pillow 47144.6/63371: 74% mana
0:54.352 aoe q arcane_explosion Fluffy_Pillow 43802.4/63371: 69% mana arcane_charge
0:55.660 aoe q arcane_explosion Fluffy_Pillow 40460.2/63371: 64% mana arcane_charge(2), clearcasting
0:56.967 aoe q arcane_explosion Fluffy_Pillow 42116.8/63371: 66% mana arcane_charge(3)
0:58.273 aoe r arcane_barrage Fluffy_Pillow 38772.0/63371: 61% mana arcane_charge(4), clearcasting
0:59.579 aoe q arcane_explosion Fluffy_Pillow 42962.1/63371: 68% mana clearcasting
1:00.887 aoe q arcane_explosion Fluffy_Pillow 44619.9/63371: 70% mana arcane_charge
1:02.193 aoe q arcane_explosion Fluffy_Pillow 41275.2/63371: 65% mana arcane_charge(2), clearcasting
1:03.499 aoe q arcane_explosion Fluffy_Pillow 42930.5/63371: 68% mana arcane_charge(3)
1:04.804 aoe r arcane_barrage Fluffy_Pillow 39584.5/63371: 62% mana arcane_charge(4)
1:06.110 aoe k radiant_spark Fluffy_Pillow 43774.6/63371: 69% mana
1:07.417 aoe m touch_of_the_magi Fluffy_Pillow 48637.8/69371: 70% mana combat_meditation
1:08.722 aoe o rune_of_power Fluffy_Pillow 47948.4/69371: 69% mana arcane_charge(4), combat_meditation
1:10.027 aoe r arcane_barrage Fluffy_Pillow 49759.0/69371: 72% mana arcane_charge(4), rune_of_power, combat_meditation
1:11.333 aoe p arcane_orb Fluffy_Pillow 54345.9/69371: 78% mana rune_of_power, combat_meditation
1:12.638 aoe r arcane_barrage Fluffy_Pillow 55656.5/69371: 80% mana arcane_charge(4), rune_of_power, combat_meditation
1:13.945 aoe q arcane_explosion Fluffy_Pillow 60244.7/69371: 87% mana rune_of_power, combat_meditation
1:15.253 aoe q arcane_explosion Fluffy_Pillow 57059.4/69371: 82% mana arcane_charge, rune_of_power, combat_meditation
1:16.560 aoe q arcane_explosion Fluffy_Pillow 49213.3/63371: 78% mana arcane_charge(2), rune_of_power
1:17.866 aoe q arcane_explosion Fluffy_Pillow 45868.6/63371: 72% mana arcane_charge(3), rune_of_power
1:19.172 aoe r arcane_barrage Fluffy_Pillow 42523.8/63371: 67% mana arcane_charge(4), rune_of_power
1:20.478 aoe q arcane_explosion Fluffy_Pillow 46713.9/63371: 74% mana rune_of_power
1:21.784 aoe q arcane_explosion Fluffy_Pillow 43369.2/63371: 68% mana arcane_charge, rune_of_power
1:23.092 aoe q arcane_explosion Fluffy_Pillow 40027.0/63371: 63% mana arcane_charge(2)
1:24.399 aoe q arcane_explosion Fluffy_Pillow 36683.5/63371: 58% mana arcane_charge(3)
1:25.707 aoe r arcane_barrage Fluffy_Pillow 33341.3/63371: 53% mana arcane_charge(4), clearcasting
1:27.012 aoe q arcane_explosion Fluffy_Pillow 37530.2/63371: 59% mana clearcasting
1:28.318 aoe q arcane_explosion Fluffy_Pillow 39185.4/63371: 62% mana arcane_charge
1:29.622 aoe q arcane_explosion Fluffy_Pillow 35838.2/63371: 57% mana arcane_charge(2)
1:30.928 aoe q arcane_explosion Fluffy_Pillow 32493.4/63371: 51% mana arcane_charge(3)
1:32.235 aoe r arcane_barrage Fluffy_Pillow 29150.0/63371: 46% mana arcane_charge(4)
1:33.541 aoe p arcane_orb Fluffy_Pillow 33340.1/63371: 53% mana
1:34.847 aoe r arcane_barrage Fluffy_Pillow 34495.3/63371: 54% mana arcane_charge(4)
1:36.154 aoe q arcane_explosion Fluffy_Pillow 38686.7/63371: 61% mana
1:37.460 aoe j radiant_spark Fluffy_Pillow 35342.0/63371: 56% mana arcane_charge
1:38.768 aoe q arcane_explosion Fluffy_Pillow 35999.8/63371: 57% mana arcane_charge
1:40.075 aoe q arcane_explosion Fluffy_Pillow 32656.3/63371: 52% mana arcane_charge(2)
1:41.381 aoe q arcane_explosion Fluffy_Pillow 29311.6/63371: 46% mana arcane_charge(3)
1:42.687 aoe r arcane_barrage Fluffy_Pillow 25966.8/63371: 41% mana arcane_charge(4), clearcasting
1:43.994 aoe q arcane_explosion Fluffy_Pillow 30158.2/63371: 48% mana clearcasting
1:45.300 aoe q arcane_explosion Fluffy_Pillow 31813.5/63371: 50% mana arcane_charge
1:46.606 aoe q arcane_explosion Fluffy_Pillow 28468.7/63371: 45% mana arcane_charge(2)
1:47.913 aoe q arcane_explosion Fluffy_Pillow 25125.3/63371: 40% mana arcane_charge(3)
1:49.220 aoe r arcane_barrage Fluffy_Pillow 21781.8/63371: 34% mana arcane_charge(4)
1:50.526 aoe q arcane_explosion Fluffy_Pillow 25971.9/63371: 41% mana
1:51.832 aoe q arcane_explosion Fluffy_Pillow 22627.2/63371: 36% mana arcane_charge
1:53.139 aoe q arcane_explosion Fluffy_Pillow 19283.7/63371: 30% mana arcane_charge(2)
1:54.445 aoe q arcane_explosion Fluffy_Pillow 15939.0/63371: 25% mana arcane_charge(3)
1:55.752 aoe r arcane_barrage Fluffy_Pillow 12595.5/63371: 20% mana arcane_charge(4), clearcasting
1:57.059 aoe m touch_of_the_magi Fluffy_Pillow 16786.9/63371: 26% mana clearcasting
1:58.367 aoe o rune_of_power Fluffy_Pillow 15944.7/63371: 25% mana arcane_charge(4), clearcasting
1:59.674 aoe r arcane_barrage Fluffy_Pillow 17601.2/63371: 28% mana arcane_charge(4), clearcasting, rune_of_power
2:00.981 aoe p arcane_orb Fluffy_Pillow 21792.6/63371: 34% mana clearcasting, rune_of_power
2:02.288 aoe r arcane_barrage Fluffy_Pillow 22949.1/63371: 36% mana arcane_charge(4), clearcasting, rune_of_power
2:03.595 aoe q arcane_explosion Fluffy_Pillow 27140.5/63371: 43% mana clearcasting, rune_of_power
2:04.901 aoe q arcane_explosion Fluffy_Pillow 28795.8/63371: 45% mana arcane_charge, rune_of_power
2:06.207 aoe q arcane_explosion Fluffy_Pillow 25451.0/63371: 40% mana arcane_charge(2), rune_of_power
2:07.513 aoe q arcane_explosion Fluffy_Pillow 22106.3/63371: 35% mana arcane_charge(3), rune_of_power
2:08.820 aoe r arcane_barrage Fluffy_Pillow 18762.8/63371: 30% mana arcane_charge(4), rune_of_power
2:10.127 aoe q arcane_explosion Fluffy_Pillow 22954.2/63371: 36% mana rune_of_power
2:11.434 aoe q arcane_explosion Fluffy_Pillow 19610.7/63371: 31% mana arcane_charge, clearcasting, rune_of_power
2:12.739 aoe q arcane_explosion Fluffy_Pillow 21264.7/63371: 34% mana arcane_charge(2)
2:14.044 aoe q arcane_explosion Fluffy_Pillow 17918.7/63371: 28% mana arcane_charge(3)
2:15.348 aoe l radiant_spark Fluffy_Pillow 14571.5/63371: 23% mana arcane_charge(4)
2:16.656 aoe n arcane_power Fluffy_Pillow 16671.2/69371: 24% mana arcane_charge(4), combat_meditation
2:16.656 aoe r arcane_barrage Fluffy_Pillow 16671.2/69371: 24% mana arcane_charge(4), arcane_power, rune_of_power, combat_meditation
2:17.963 aoe q arcane_explosion Fluffy_Pillow 21259.4/69371: 31% mana arcane_power, rune_of_power, combat_meditation
2:19.269 aoe q arcane_explosion Fluffy_Pillow 20571.4/69371: 30% mana arcane_charge, arcane_power, rune_of_power, combat_meditation
2:20.574 aoe q arcane_explosion Fluffy_Pillow 19882.0/69371: 29% mana arcane_charge(2), arcane_power, rune_of_power, combat_meditation
2:21.878 aoe q arcane_explosion Fluffy_Pillow 19191.2/69371: 28% mana arcane_charge(3), arcane_power, rune_of_power, combat_meditation
2:23.186 shared_cds t use_mana_gem Kyrian_Pelagos 18505.9/69371: 27% mana arcane_charge(4), arcane_power, rune_of_power, combat_meditation
2:23.186 aoe r arcane_barrage Fluffy_Pillow 25443.1/69371: 37% mana arcane_charge(4), arcane_power, rune_of_power, combat_meditation
2:24.491 aoe p arcane_orb Fluffy_Pillow 30028.5/69371: 43% mana arcane_power, rune_of_power, combat_meditation
2:25.799 aoe r arcane_barrage Fluffy_Pillow 28860.7/63371: 46% mana arcane_charge(4), arcane_power, rune_of_power
2:27.106 aoe q arcane_explosion Fluffy_Pillow 33052.1/63371: 52% mana arcane_power, rune_of_power
2:28.414 aoe q arcane_explosion Fluffy_Pillow 32209.9/63371: 51% mana arcane_charge, arcane_power, rune_of_power
2:29.723 aoe q arcane_explosion Fluffy_Pillow 31369.0/63371: 50% mana arcane_charge(2), arcane_power
2:31.028 aoe q arcane_explosion Fluffy_Pillow 30523.0/63371: 48% mana arcane_charge(3), arcane_power
2:32.335 aoe r arcane_barrage Fluffy_Pillow 29679.5/63371: 47% mana arcane_charge(4)
2:33.642 aoe q arcane_explosion Fluffy_Pillow 33870.9/63371: 53% mana
2:34.949 aoe q arcane_explosion Fluffy_Pillow 30527.4/63371: 48% mana arcane_charge
2:36.255 aoe q arcane_explosion Fluffy_Pillow 27182.7/63371: 43% mana arcane_charge(2), clearcasting
2:37.562 aoe q arcane_explosion Fluffy_Pillow 28839.2/63371: 46% mana arcane_charge(3)
2:38.869 aoe r arcane_barrage Fluffy_Pillow 25495.7/63371: 40% mana arcane_charge(4), clearcasting
2:40.175 aoe q arcane_explosion Fluffy_Pillow 29685.9/63371: 47% mana clearcasting
2:41.481 aoe q arcane_explosion Fluffy_Pillow 31341.1/63371: 49% mana arcane_charge
2:42.787 aoe q arcane_explosion Fluffy_Pillow 27996.4/63371: 44% mana arcane_charge(2)
2:44.093 aoe q arcane_explosion Fluffy_Pillow 24651.7/63371: 39% mana arcane_charge(3)
2:45.400 aoe r arcane_barrage Fluffy_Pillow 21308.2/63371: 34% mana arcane_charge(4)
2:46.706 aoe k radiant_spark Fluffy_Pillow 25498.3/63371: 40% mana
2:48.013 aoe m touch_of_the_magi Fluffy_Pillow 26154.8/63371: 41% mana
2:49.318 aoe o rune_of_power Fluffy_Pillow 25308.8/63371: 40% mana arcane_charge(4)
2:50.624 aoe r arcane_barrage Fluffy_Pillow 26964.1/63371: 43% mana arcane_charge(4), rune_of_power
2:51.930 aoe p arcane_orb Fluffy_Pillow 31154.2/63371: 49% mana rune_of_power
2:53.237 aoe r arcane_barrage Fluffy_Pillow 32310.7/63371: 51% mana arcane_charge(4), rune_of_power
2:54.544 aoe q arcane_explosion Fluffy_Pillow 36502.1/63371: 58% mana rune_of_power
2:55.852 aoe q arcane_explosion Fluffy_Pillow 33159.9/63371: 52% mana arcane_charge, rune_of_power
2:57.159 aoe q arcane_explosion Fluffy_Pillow 29816.4/63371: 47% mana arcane_charge(2), rune_of_power
2:58.464 aoe q arcane_explosion Fluffy_Pillow 26470.4/63371: 42% mana arcane_charge(3), clearcasting, rune_of_power
2:59.771 aoe r arcane_barrage Fluffy_Pillow 28127.0/63371: 44% mana arcane_charge(4), rune_of_power
3:01.079 aoe q arcane_explosion Fluffy_Pillow 32319.6/63371: 51% mana rune_of_power
3:02.386 aoe q arcane_explosion Fluffy_Pillow 28976.2/63371: 46% mana arcane_charge, rune_of_power
3:03.693 aoe q arcane_explosion Fluffy_Pillow 25632.7/63371: 40% mana arcane_charge(2)
3:05.000 aoe q arcane_explosion Fluffy_Pillow 22289.2/63371: 35% mana arcane_charge(3)
3:06.306 aoe r arcane_barrage Fluffy_Pillow 18944.5/63371: 30% mana arcane_charge(4)
3:07.612 aoe q arcane_explosion Fluffy_Pillow 23134.6/63371: 37% mana
3:08.917 aoe q arcane_explosion Fluffy_Pillow 19788.6/63371: 31% mana arcane_charge
3:10.224 aoe q arcane_explosion Fluffy_Pillow 16445.1/63371: 26% mana arcane_charge(2)
3:11.529 aoe q arcane_explosion Fluffy_Pillow 13099.1/63371: 21% mana arcane_charge(3)
3:12.835 aoe r arcane_barrage Fluffy_Pillow 9754.4/63371: 15% mana arcane_charge(4)
3:14.140 aoe p arcane_orb Fluffy_Pillow 13943.2/63371: 22% mana
3:15.445 aoe r arcane_barrage Fluffy_Pillow 15097.2/63371: 24% mana arcane_charge(4)
3:16.751 aoe q arcane_explosion Fluffy_Pillow 19287.3/63371: 30% mana
3:18.058 aoe j radiant_spark Fluffy_Pillow 15943.9/63371: 25% mana arcane_charge, clearcasting
3:19.365 aoe q arcane_explosion Fluffy_Pillow 18172.1/69371: 26% mana arcane_charge, clearcasting, combat_meditation
3:20.672 aoe q arcane_explosion Fluffy_Pillow 19985.5/69371: 29% mana arcane_charge(2), combat_meditation
3:21.978 aoe q arcane_explosion Fluffy_Pillow 16797.5/69371: 24% mana arcane_charge(3), combat_meditation
3:23.285 aoe r arcane_barrage Fluffy_Pillow 13610.8/69371: 20% mana arcane_charge(4), combat_meditation
3:24.591 aoe q arcane_explosion Fluffy_Pillow 18197.7/69371: 26% mana combat_meditation
3:25.897 aoe q arcane_explosion Fluffy_Pillow 15009.7/69371: 22% mana arcane_charge, combat_meditation
3:27.203 aoe q arcane_explosion Fluffy_Pillow 11821.6/69371: 17% mana arcane_charge(2), clearcasting, combat_meditation
3:28.509 aoe q arcane_explosion Fluffy_Pillow 12454.4/63371: 20% mana arcane_charge(3)
3:29.816 aoe r arcane_barrage Fluffy_Pillow 9111.0/63371: 14% mana arcane_charge(4), clearcasting
3:31.124 aoe q arcane_explosion Fluffy_Pillow 13303.6/63371: 21% mana clearcasting
3:32.432 aoe q arcane_explosion Fluffy_Pillow 14961.4/63371: 24% mana arcane_charge
3:33.741 aoe q arcane_explosion Fluffy_Pillow 11620.5/63371: 18% mana arcane_charge(2)
3:35.048 aoe q arcane_explosion Fluffy_Pillow 8277.0/63371: 13% mana arcane_charge(3)
3:36.355 aoe r arcane_barrage Fluffy_Pillow 4933.5/63371: 8% mana arcane_charge(4)
3:37.661 aoe m touch_of_the_magi Fluffy_Pillow 9123.7/63371: 14% mana
3:38.969 aoe o rune_of_power Fluffy_Pillow 8281.5/63371: 13% mana arcane_charge(4)
3:40.275 aoe r arcane_barrage Fluffy_Pillow 9936.7/63371: 16% mana arcane_charge(4), rune_of_power
3:41.582 aoe p arcane_orb Fluffy_Pillow 14128.1/63371: 22% mana rune_of_power
3:42.889 aoe r arcane_barrage Fluffy_Pillow 15284.6/63371: 24% mana arcane_charge(4), rune_of_power
3:44.197 aoe q arcane_explosion Fluffy_Pillow 19477.3/63371: 31% mana rune_of_power
3:45.505 aoe q arcane_explosion Fluffy_Pillow 16135.1/63371: 25% mana arcane_charge, rune_of_power
3:46.811 aoe q arcane_explosion Fluffy_Pillow 12790.3/63371: 20% mana arcane_charge(2), rune_of_power
3:48.116 aoe q arcane_explosion Fluffy_Pillow 9444.3/63371: 15% mana arcane_charge(3), rune_of_power
3:49.421 aoe r arcane_barrage Fluffy_Pillow 6098.3/63371: 10% mana arcane_charge(4), rune_of_power
3:50.727 aoe j radiant_spark Fluffy_Pillow 10288.4/63371: 16% mana rune_of_power
3:52.033 aoe q arcane_explosion Fluffy_Pillow 10943.7/63371: 17% mana rune_of_power
3:53.341 aoe q arcane_explosion Fluffy_Pillow 7601.5/63371: 12% mana arcane_charge
3:54.648 aoe s evocation Kyrian_Pelagos 4258.0/63371: 7% mana arcane_charge(2)
3:58.991 aoe q arcane_explosion Fluffy_Pillow 58101.4/63371: 92% mana arcane_charge(2)
4:00.296 aoe q arcane_explosion Fluffy_Pillow 54755.4/63371: 86% mana arcane_charge(3)
4:01.603 aoe r arcane_barrage Fluffy_Pillow 51412.0/63371: 81% mana arcane_charge(4)
4:02.910 aoe p arcane_orb Fluffy_Pillow 55603.3/63371: 88% mana
4:04.218 aoe r arcane_barrage Fluffy_Pillow 56761.1/63371: 90% mana arcane_charge(4)
4:05.524 aoe q arcane_explosion Fluffy_Pillow 60951.3/63371: 96% mana
4:06.831 aoe q arcane_explosion Fluffy_Pillow 57607.8/63371: 91% mana arcane_charge
4:08.137 aoe q arcane_explosion Fluffy_Pillow 54263.1/63371: 86% mana arcane_charge(2)
4:09.443 aoe q arcane_explosion Fluffy_Pillow 50918.3/63371: 80% mana arcane_charge(3)
4:10.750 aoe r arcane_barrage Fluffy_Pillow 47574.8/63371: 75% mana arcane_charge(4)
4:12.058 aoe q arcane_explosion Fluffy_Pillow 51767.5/63371: 82% mana
4:13.363 aoe q arcane_explosion Fluffy_Pillow 48421.5/63371: 76% mana arcane_charge
4:14.667 aoe q arcane_explosion Fluffy_Pillow 45074.2/63371: 71% mana arcane_charge(2)
4:15.976 aoe q arcane_explosion Fluffy_Pillow 41733.3/63371: 66% mana arcane_charge(3), clearcasting
4:17.284 aoe r arcane_barrage Fluffy_Pillow 43391.1/63371: 68% mana arcane_charge(4)
4:18.591 aoe q arcane_explosion Fluffy_Pillow 47582.5/63371: 75% mana
4:19.897 aoe q arcane_explosion Fluffy_Pillow 44237.7/63371: 70% mana arcane_charge, clearcasting
4:21.203 aoe q arcane_explosion Fluffy_Pillow 45893.0/63371: 72% mana arcane_charge(2)
4:22.510 aoe q arcane_explosion Fluffy_Pillow 42549.5/63371: 67% mana arcane_charge(3)
4:23.816 shared_cds t use_mana_gem Kyrian_Pelagos 39204.8/63371: 62% mana arcane_charge(4)
4:23.816 aoe r arcane_barrage Fluffy_Pillow 45541.9/63371: 72% mana arcane_charge(4)
4:25.122 aoe k radiant_spark Fluffy_Pillow 49732.0/63371: 78% mana
4:26.428 aoe m touch_of_the_magi Fluffy_Pillow 55158.0/69371: 80% mana combat_meditation
4:27.735 aoe n arcane_power Fluffy_Pillow 54471.3/69371: 79% mana arcane_charge(4), combat_meditation
4:27.735 shared_cds v berserking Fluffy_Pillow 54471.3/69371: 79% mana arcane_charge(4), arcane_power, rune_of_power, combat_meditation
4:27.735 aoe r arcane_barrage Fluffy_Pillow 54471.3/69371: 79% mana berserking, arcane_charge(4), arcane_power, rune_of_power, combat_meditation
4:28.923 aoe p arcane_orb Fluffy_Pillow 58894.5/69371: 85% mana berserking, arcane_power, rune_of_power, combat_meditation
4:30.110 aoe r arcane_barrage Fluffy_Pillow 60291.3/69371: 87% mana berserking, arcane_charge(4), arcane_power, rune_of_power, combat_meditation
4:31.299 aoe q arcane_explosion Fluffy_Pillow 64715.8/69371: 93% mana berserking, arcane_power, rune_of_power, combat_meditation
4:32.488 aoe q arcane_explosion Fluffy_Pillow 63865.5/69371: 92% mana berserking, arcane_charge, arcane_power, rune_of_power, combat_meditation
4:33.677 aoe q arcane_explosion Fluffy_Pillow 63015.2/69371: 91% mana berserking, arcane_charge(2), arcane_power, rune_of_power, combat_meditation
4:34.865 aoe q arcane_explosion Fluffy_Pillow 56786.8/63371: 90% mana berserking, arcane_charge(3), arcane_power, rune_of_power
4:36.054 aoe r arcane_barrage Fluffy_Pillow 55793.8/63371: 88% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:37.243 aoe q arcane_explosion Fluffy_Pillow 59835.6/63371: 94% mana berserking, arcane_power, rune_of_power
4:38.432 aoe q arcane_explosion Fluffy_Pillow 58842.6/63371: 93% mana berserking, arcane_charge, arcane_power, rune_of_power
4:39.620 aoe q arcane_explosion Fluffy_Pillow 57848.3/63371: 91% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:40.808 aoe q arcane_explosion Fluffy_Pillow 56854.0/63371: 90% mana arcane_charge(3), arcane_power
4:42.113 aoe o rune_of_power Fluffy_Pillow 56008.0/63371: 88% mana arcane_charge(4), arcane_power, clearcasting

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Kyrian_Pelagos"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=kyrian
soulbind=328266//arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Necrolord_Emeni : 17087 dps, 4695 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17087.4 17087.4 32.2 / 0.189% 1967.9 / 11.5% 8.3
RPS Out RPS In Primary Resource Waiting APM Active Skill
2045.9 1944.8 Mana 0.00% 49.6 100.0% 100%
Talents
Necrolord

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Necrolord_Emeni 17087
Arcane Barrage 5998 35.1% 56.9 5.28sec 31710 25417 Direct 284.2 5339 10603 6353 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 56.93 284.24 0.00 0.00 1.2476 0.0000 1805242.54 1805242.54 0.00% 25417.36 25417.36
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 229.46 171 286 5338.82 2082 31802 5327.90 4607 5882 1224545 1224545 0.00%
crit 19.27% 54.78 28 85 10603.08 4164 63605 10585.59 7893 13985 580697 580697 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [q]:56.93
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 434 2.5% 36.5 7.76sec 3574 0 Direct 182.4 599 1199 715 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.49 182.43 0.00 0.00 0.0000 0.0000 130402.13 130402.13 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 147.26 102 196 599.34 443 841 598.78 542 643 88244 88244 0.00%
crit 19.28% 35.17 15 59 1199.35 886 1681 1197.38 985 1427 42158 42158 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 8099 47.4% 153.8 1.92sec 15825 12739 Direct 769.1 2653 5309 3166 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 153.83 769.13 0.00 0.00 1.2423 0.0000 2434271.32 2434271.32 0.00% 12738.67 12738.67
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.71% 620.75 480 769 2653.48 1958 5201 2651.62 2518 2783 1646611 1646611 0.00%
crit 19.29% 148.38 103 206 5309.24 3916 10402 5306.38 4708 5812 787660 787660 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [p]:153.83
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1441) 0.0% (8.4%) 13.0 23.74sec 33199 26628

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.05 0.00 0.00 0.00 1.2468 0.0000 0.00 0.00 0.00% 26628.15 26628.15

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [o]:13.05
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1441 8.4% 65.1 23.74sec 6652 0 Direct 65.1 5589 11152 6654 19.1%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 65.12 65.12 0.00 0.00 0.0000 0.0000 433213.37 433213.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.86% 52.66 37 68 5589.02 3869 10279 5588.20 4935 6425 294253 294253 0.00%
crit 19.14% 12.46 3 24 11152.08 7739 20558 11154.56 8126 16204 138960 138960 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (69) 0.0% (0.4%) 14.7 1.75sec 1391 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.71 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 69 0.4% 14.7 1.75sec 1391 0 Direct 14.7 1164 2327 1391 19.6%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.71 14.71 0.00 0.00 0.0000 0.0000 20466.95 20466.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.42% 11.83 4 19 1163.53 1164 1164 1163.53 1164 1164 13765 13765 0.00%
crit 19.58% 2.88 0 8 2327.06 2327 2327 2221.91 0 2327 6702 6702 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1771 19.7%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1773.03 1773.03 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.26% 0.80 0 1 1480.68 1481 1481 1188.32 0 1481 1188 1188 0.00%
crit 19.74% 0.20 0 1 2961.35 2961 2961 584.71 0 2961 585 585 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (22) 0.0% (0.1%) 1.0 0.00sec 6517 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 163  / 22 0.1% 90.0 1.29sec 72 55 Direct 90.0 61 121 72 19.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 6516.84 6516.84 0.00% 55.33 55.33
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.77% 72.69 58 83 60.74 43 69 60.73 59 63 4415 4415 0.00%
crit 19.23% 17.31 7 32 121.41 86 139 121.45 105 136 2102 2102 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (1018) 0.0% (6.0%) 6.1 52.63sec 49793 39594

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.15 0.00 0.00 0.00 1.2577 0.0000 0.00 0.00 0.00% 39594.10 39594.10

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.16
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 1018 6.0% 6.1 52.54sec 49793 0 Direct 30.6 10005 0 10005 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.15 30.60 0.00 0.00 0.0000 0.0000 306141.60 306141.60 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 30.60 25 35 10004.88 2143 63424 9992.33 6921 13656 306142 306142 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:34480.62
  • base_dd_max:34480.62
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Necrolord_Emeni
Arcane Power 2.8 128.55sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.85
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 257.13sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [u]:1.85
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Deathborne 1.9 257.11sec

Stats Details: Deathborne

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.86 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathborne

  • id:324220
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:324220
  • name:Deathborne
  • school:shadow
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.

Action Priority List

    aoe
    [j]:1.86
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Evocation 1.2 177.62sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.18 0.00 7.04 0.00 4.3098 0.7222 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [r]:1.18
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [t]:1.00
  • if_expr:buff.arcane_power.up
Presence of Mind 1.0 0.00sec

Stats Details: Presence Of Mind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Presence Of Mind

  • id:205025
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:205025
  • name:Presence of Mind
  • school:arcane
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.

Action Priority List

    aoe
    [n]:1.00
  • if_expr:buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
Rune of Power 6.0 50.66sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.01 0.00 0.00 0.00 1.2566 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:6.03
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.52sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Emeni
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [s]:2.75
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 57.7 180.5 5.2sec 1.3sec 3.8sec 73.54% 0.00% 26.9 (27.0) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.9s

Stack Uptimes

  • arcane_charge_1:19.01%
  • arcane_charge_2:16.33%
  • arcane_charge_3:16.67%
  • arcane_charge_4:21.52%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 128.4sec 128.4sec 14.6sec 13.87% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.4s / 135.0s
  • trigger_min/max:120.4s / 135.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:13.87%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 256.8sec 256.8sec 11.6sec 7.11% 23.75% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:246.2s / 263.2s
  • trigger_min/max:246.2s / 263.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:7.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.4 0.1 11.9sec 11.8sec 2.0sec 15.91% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:15.79%
  • clearcasting_2:0.14%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Deathborne 1.9 0.0 256.9sec 256.9sec 19.1sec 11.66% 0.00% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_deathborne
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:247.3s / 262.9s
  • trigger_min/max:247.3s / 262.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 20.0s

Stack Uptimes

  • deathborne_1:11.66%

Spelldata

  • id:324220
  • name:Deathborne
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Evocation 1.2 0.0 170.9sec 170.9sec 4.3sec 1.69% 0.00% 4.7 (4.7) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:104.9s / 263.1s
  • trigger_min/max:104.9s / 263.1s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 4.3s

Stack Uptimes

  • evocation_1:1.69%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Lead by Example 1.9 0.0 256.9sec 256.9sec 28.0sec 17.06% 0.00% 0.0 (0.0) 1.6

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_lead_by_example
  • max_stacks:1
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:247.3s / 262.9s
  • trigger_min/max:247.3s / 262.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 30.0s

Stack Uptimes

  • lead_by_example_1:17.06%

Spelldata

  • id:342181
  • name:Lead by Example
  • tooltip:$pri increased by $w1%.
  • description:{$@spelldesc342156=$?a137005[Abomination Limb]?a212611[Fodder to the Flame]?a137009[Adaptive Swarm]?a137014[Death Chakram]?a137018[Deathborne]?a137022[Bonedust Brew]?a137026[Vanquisher's Hammer]?a137030[Unholy Nova]?a137034[Serrated Bone Spike]?a137038[Primordial Wave]?a137042[Decimating Bolt]?a137047[Conqueror's Banner][Activating your Necrolord class ability] increases your $pri by {$342181s2=5}% and nearby allies' primary stat by {$342181s1=2}% for ${{$s3=10}*$<mod>}.1 sec. You gain {$342181s2=5}% additional $pri for each ally affected, up to ${({$342181s3=3}*{$342181s2=5})}%.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.43% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.43%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Presence of Mind 1.0 0.0 0.0sec 0.0sec 293.8sec 97.68% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_presence_of_mind
  • max_stacks:3
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:233.2s / 353.0s

Stack Uptimes

  • presence_of_mind_3:97.68%

Spelldata

  • id:205025
  • name:Presence of Mind
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.
  • max_stacks:0
  • duration:-0.00
  • cooldown:60.00
  • default_chance:100.00%
Rune of Power 8.9 0.0 35.2sec 35.2sec 11.8sec 34.71% 0.00% 0.0 (0.0) 8.5

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.5s / 55.3s
  • trigger_min/max:13.5s / 55.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • rune_of_power_1:34.71%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.82% 0.53% 5.93% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 300.7s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.660120.091239.937
Evocation143.88414.943352.273212.653125.470352.273
Rune of Power6.6620.06723.38741.35225.30456.002
Touch of the Magi5.5260.00021.83235.22023.99755.248
Arcane Power6.2810.37414.99818.1642.70725.532
Arcane Barrage2.7850.0029.582159.612126.653193.157
Arcane Orb3.6790.00010.48448.40834.19763.684
Deathborne34.9250.00081.61774.53558.789147.731
Presence of Mind6.8856.8786.8956.8856.8786.895

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Necrolord_Emeni
mana_regen Mana 513.82 371834.95 63.61% 723.67 8567.05 2.25%
Evocation Mana 56.30 56596.42 9.68% 1005.34 0.00 0.00%
Mana Gem Mana 2.75 17424.08 2.98% 6337.14 0.00 0.00%
Arcane Barrage Mana 56.93 138738.07 23.73% 2436.94 5574.73 3.86%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1944.79 2045.92 14134.3 32968.5 1097.6 63371.4
Usage Type Count Total Avg RPE APR
Necrolord_Emeni
arcane_explosion Mana 153.8 588133.5 3823.3 3823.4 4.1
arcane_orb Mana 13.0 5860.7 449.2 449.1 73.9
deathborne Mana 1.9 4644.6 2500.0 2503.0 0.0
touch_of_the_magi Mana 6.1 15365.1 2500.0 2499.1 19.9

Statistics & Data Analysis

Fight Length
Necrolord_Emeni Fight Length
Count 1018
Mean 300.66
Minimum 240.09
Maximum 359.94
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
Necrolord_Emeni Damage Per Second
Count 1018
Mean 17087.45
Minimum 15685.68
Maximum 18661.77
Spread ( max - min ) 2976.09
Range [ ( max - min ) / 2 * 100% ] 8.71%
Standard Deviation 524.7133
5th Percentile 16200.02
95th Percentile 17922.75
( 95th Percentile - 5th Percentile ) 1722.73
Mean Distribution
Standard Deviation 16.4455
95.00% Confidence Interval ( 17055.22 - 17119.68 )
Normalized 95.00% Confidence Interval ( 99.81% - 100.19% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3623
0.1 Scale Factor Error with Delta=300 2351
0.05 Scale Factor Error with Delta=300 9402
0.01 Scale Factor Error with Delta=300 235033
Priority Target DPS
Necrolord_Emeni Priority Target Damage Per Second
Count 1018
Mean 4695.09
Minimum 4082.13
Maximum 5318.02
Spread ( max - min ) 1235.89
Range [ ( max - min ) / 2 * 100% ] 13.16%
Standard Deviation 207.5529
5th Percentile 4362.76
95th Percentile 5046.80
( 95th Percentile - 5th Percentile ) 684.04
Mean Distribution
Standard Deviation 6.5051
95.00% Confidence Interval ( 4682.34 - 4707.83 )
Normalized 95.00% Confidence Interval ( 99.73% - 100.27% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 76
0.1% Error 7508
0.1 Scale Factor Error with Delta=300 368
0.05 Scale Factor Error with Delta=300 1471
0.01 Scale Factor Error with Delta=300 36775
DPS(e)
Necrolord_Emeni Damage Per Second (Effective)
Count 1018
Mean 17087.45
Minimum 15685.68
Maximum 18661.77
Spread ( max - min ) 2976.09
Range [ ( max - min ) / 2 * 100% ] 8.71%
Damage
Necrolord_Emeni Damage
Count 1018
Mean 5131510.93
Minimum 3847542.48
Maximum 6096565.34
Spread ( max - min ) 2249022.86
Range [ ( max - min ) / 2 * 100% ] 21.91%
DTPS
Necrolord_Emeni Damage Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Necrolord_Emeni Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Necrolord_Emeni Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Necrolord_Emeni Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Necrolord_Emeni Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Necrolord_Emeni Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Necrolord_EmeniTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Necrolord_Emeni Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 1.86 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.16 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.85 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 6.03 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
n 1.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
o 13.05 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
p 153.83 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
q 56.93 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
r 1.18 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
s 2.75 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
t 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
u 1.85 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjkltuqoqppnppqppppqppppmqppppsqoqppppqppppqppppqppppqoqppppqppppqkmqppppqoqppppqppppqppppqoqppppqppppqkmqppppqoqpppplqppppqppppsqoqppppqppppqkmqppppqoqppppqppppqppppqoqppppqprkmqppppqoqppppqppppqppppqoqppppqppppqjkluqpppspqoqppppmqppppq

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Necrolord_Emeni 63371.4/63371: 100% mana
Pre precombat R food Necrolord_Emeni 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j deathborne Fluffy_Pillow 62371.4/63371: 98% mana
0:01.307 aoe k touch_of_the_magi Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, deathborne, lead_by_example
0:02.314 aoe l arcane_power Fluffy_Pillow 59654.1/63371: 94% mana bloodlust, arcane_charge(4), deathborne, lead_by_example
0:02.314 shared_cds t potion Fluffy_Pillow 59654.1/63371: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example
0:02.314 shared_cds u berserking Fluffy_Pillow 59654.1/63371: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:02.314 aoe q arcane_barrage Fluffy_Pillow 59654.1/63371: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:03.228 aoe o arcane_orb Fluffy_Pillow 63347.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:04.141 aoe q arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:05.055 aoe p arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:05.969 aoe p arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, clearcasting, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:06.883 aoe n presence_of_mind Fluffy_Pillow 63188.3/63371: 100% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:06.883 aoe p arcane_explosion Fluffy_Pillow 63188.3/63371: 100% mana bloodlust, berserking, arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:07.797 aoe p arcane_explosion Fluffy_Pillow 61846.7/63371: 98% mana bloodlust, berserking, arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:08.713 aoe q arcane_barrage Fluffy_Pillow 60507.7/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:09.629 aoe p arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:10.544 aoe p arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:11.460 aoe p arcane_explosion Fluffy_Pillow 60692.1/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:12.375 aoe p arcane_explosion Fluffy_Pillow 59351.8/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:13.289 aoe q arcane_barrage Fluffy_Pillow 58010.2/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:14.204 aoe p arcane_explosion Fluffy_Pillow 61704.8/63371: 97% mana bloodlust, berserking, arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:15.119 aoe p arcane_explosion Fluffy_Pillow 60364.5/63371: 95% mana bloodlust, arcane_charge, arcane_power, presence_of_mind(3), deathborne, lead_by_example, potion_of_deathly_fixation
0:16.126 aoe p arcane_explosion Fluffy_Pillow 59140.8/63371: 93% mana bloodlust, arcane_charge(2), arcane_power, presence_of_mind(3), deathborne, lead_by_example, potion_of_deathly_fixation
0:17.133 aoe p arcane_explosion Fluffy_Pillow 57917.1/63371: 91% mana bloodlust, arcane_charge(3), arcane_power, presence_of_mind(3), deathborne, lead_by_example, potion_of_deathly_fixation
0:18.138 aoe m rune_of_power Fluffy_Pillow 56690.8/63371: 89% mana bloodlust, arcane_charge(4), presence_of_mind(3), deathborne, lead_by_example, potion_of_deathly_fixation
0:19.144 aoe q arcane_barrage Fluffy_Pillow 57965.9/63371: 91% mana bloodlust, arcane_charge(4), presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:20.149 aoe p arcane_explosion Fluffy_Pillow 61774.5/63371: 97% mana bloodlust, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:21.155 aoe p arcane_explosion Fluffy_Pillow 58049.5/63371: 92% mana bloodlust, arcane_charge, clearcasting, presence_of_mind(3), rune_of_power, deathborne, lead_by_example, potion_of_deathly_fixation
0:22.161 aoe p arcane_explosion Fluffy_Pillow 59324.6/63371: 94% mana bloodlust, arcane_charge(2), presence_of_mind(3), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:23.167 aoe p arcane_explosion Fluffy_Pillow 55599.6/63371: 88% mana bloodlust, arcane_charge(3), presence_of_mind(3), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:24.176 shared_cds s use_mana_gem Necrolord_Emeni 51878.4/63371: 82% mana bloodlust, arcane_charge(4), presence_of_mind(3), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:24.176 aoe q arcane_barrage Fluffy_Pillow 58215.6/63371: 92% mana bloodlust, arcane_charge(4), presence_of_mind(3), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:25.183 aoe o arcane_orb Fluffy_Pillow 62026.7/63371: 98% mana bloodlust, presence_of_mind(3), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:26.190 aoe q arcane_barrage Fluffy_Pillow 62803.0/63371: 99% mana bloodlust, arcane_charge(4), presence_of_mind(3), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:27.197 aoe p arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, presence_of_mind(3), rune_of_power, lead_by_example, potion_of_deathly_fixation
0:28.203 aoe p arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge, presence_of_mind(3), rune_of_power, lead_by_example
0:29.209 aoe p arcane_explosion Fluffy_Pillow 55921.5/63371: 88% mana bloodlust, arcane_charge(2), presence_of_mind(3), rune_of_power, lead_by_example
0:30.216 aoe p arcane_explosion Fluffy_Pillow 52197.8/63371: 82% mana bloodlust, arcane_charge(3), presence_of_mind(3), rune_of_power, lead_by_example
0:31.222 aoe q arcane_barrage Fluffy_Pillow 48472.8/63371: 76% mana bloodlust, arcane_charge(4), presence_of_mind(3), lead_by_example
0:32.230 aoe p arcane_explosion Fluffy_Pillow 52285.3/63371: 83% mana bloodlust, presence_of_mind(3)
0:33.235 aoe p arcane_explosion Fluffy_Pillow 48559.0/63371: 77% mana bloodlust, arcane_charge, presence_of_mind(3)
0:34.243 aoe p arcane_explosion Fluffy_Pillow 44836.6/63371: 71% mana bloodlust, arcane_charge(2), presence_of_mind(3)
0:35.251 aoe p arcane_explosion Fluffy_Pillow 41114.2/63371: 65% mana bloodlust, arcane_charge(3), presence_of_mind(3)
0:36.257 aoe q arcane_barrage Fluffy_Pillow 37389.2/63371: 59% mana bloodlust, arcane_charge(4), presence_of_mind(3)
0:37.265 aoe p arcane_explosion Fluffy_Pillow 41201.6/63371: 65% mana bloodlust, presence_of_mind(3)
0:38.271 aoe p arcane_explosion Fluffy_Pillow 37476.6/63371: 59% mana bloodlust, arcane_charge, presence_of_mind(3)
0:39.277 aoe p arcane_explosion Fluffy_Pillow 33751.7/63371: 53% mana bloodlust, arcane_charge(2), presence_of_mind(3)
0:40.284 aoe p arcane_explosion Fluffy_Pillow 30028.0/63371: 47% mana bloodlust, arcane_charge(3), presence_of_mind(3)
0:41.292 aoe q arcane_barrage Fluffy_Pillow 26305.5/63371: 42% mana arcane_charge(4), presence_of_mind(3)
0:42.599 aoe p arcane_explosion Fluffy_Pillow 30496.9/63371: 48% mana presence_of_mind(3)
0:43.905 aoe p arcane_explosion Fluffy_Pillow 27152.2/63371: 43% mana arcane_charge, presence_of_mind(3)
0:45.212 aoe p arcane_explosion Fluffy_Pillow 23808.7/63371: 38% mana arcane_charge(2), clearcasting, presence_of_mind(3)
0:46.518 aoe p arcane_explosion Fluffy_Pillow 25464.0/63371: 40% mana arcane_charge(3), presence_of_mind(3)
0:47.826 aoe q arcane_barrage Fluffy_Pillow 22121.8/63371: 35% mana arcane_charge(4), presence_of_mind(3)
0:49.133 aoe o arcane_orb Fluffy_Pillow 26313.2/63371: 42% mana presence_of_mind(3)
0:50.439 aoe q arcane_barrage Fluffy_Pillow 27468.4/63371: 43% mana arcane_charge(4), presence_of_mind(3)
0:51.747 aoe p arcane_explosion Fluffy_Pillow 31661.1/63371: 50% mana presence_of_mind(3)
0:53.052 aoe p arcane_explosion Fluffy_Pillow 28315.1/63371: 45% mana arcane_charge, presence_of_mind(3)
0:54.360 aoe p arcane_explosion Fluffy_Pillow 24972.9/63371: 39% mana arcane_charge(2), presence_of_mind(3)
0:55.667 aoe p arcane_explosion Fluffy_Pillow 21629.4/63371: 34% mana arcane_charge(3), presence_of_mind(3)
0:56.974 aoe q arcane_barrage Fluffy_Pillow 18285.9/63371: 29% mana arcane_charge(4), presence_of_mind(3)
0:58.281 aoe p arcane_explosion Fluffy_Pillow 22477.3/63371: 35% mana presence_of_mind(3)
0:59.588 aoe p arcane_explosion Fluffy_Pillow 19133.9/63371: 30% mana arcane_charge, presence_of_mind(3)
1:00.896 aoe p arcane_explosion Fluffy_Pillow 15791.6/63371: 25% mana arcane_charge(2), clearcasting, presence_of_mind(3)
1:02.204 aoe p arcane_explosion Fluffy_Pillow 17449.4/63371: 28% mana arcane_charge(3), presence_of_mind(3)
1:03.512 aoe q arcane_barrage Fluffy_Pillow 14107.2/63371: 22% mana arcane_charge(4), presence_of_mind(3)
1:04.819 aoe k touch_of_the_magi Fluffy_Pillow 18298.6/63371: 29% mana presence_of_mind(3)
1:06.126 aoe m rune_of_power Fluffy_Pillow 17455.2/63371: 28% mana arcane_charge(4), presence_of_mind(3)
1:07.433 aoe q arcane_barrage Fluffy_Pillow 19111.7/63371: 30% mana arcane_charge(4), presence_of_mind(3), rune_of_power
1:08.741 aoe p arcane_explosion Fluffy_Pillow 23304.3/63371: 37% mana presence_of_mind(3), rune_of_power
1:10.048 aoe p arcane_explosion Fluffy_Pillow 19960.9/63371: 31% mana arcane_charge, presence_of_mind(3), rune_of_power
1:11.354 aoe p arcane_explosion Fluffy_Pillow 16616.1/63371: 26% mana arcane_charge(2), clearcasting, presence_of_mind(3), rune_of_power
1:12.662 aoe p arcane_explosion Fluffy_Pillow 18273.9/63371: 29% mana arcane_charge(3), presence_of_mind(3), rune_of_power
1:13.968 aoe q arcane_barrage Fluffy_Pillow 14929.2/63371: 24% mana arcane_charge(4), presence_of_mind(3), rune_of_power
1:15.275 aoe o arcane_orb Fluffy_Pillow 19120.6/63371: 30% mana presence_of_mind(3), rune_of_power
1:16.582 aoe q arcane_barrage Fluffy_Pillow 20277.1/63371: 32% mana arcane_charge(4), presence_of_mind(3), rune_of_power
1:17.889 aoe p arcane_explosion Fluffy_Pillow 24468.5/63371: 39% mana presence_of_mind(3), rune_of_power
1:19.195 aoe p arcane_explosion Fluffy_Pillow 21123.8/63371: 33% mana arcane_charge, presence_of_mind(3), rune_of_power
1:20.502 aoe p arcane_explosion Fluffy_Pillow 17780.3/63371: 28% mana arcane_charge(2), presence_of_mind(3)
1:21.810 aoe p arcane_explosion Fluffy_Pillow 14438.1/63371: 23% mana arcane_charge(3), presence_of_mind(3)
1:23.116 aoe q arcane_barrage Fluffy_Pillow 11093.3/63371: 18% mana arcane_charge(4), clearcasting, presence_of_mind(3)
1:24.424 aoe p arcane_explosion Fluffy_Pillow 15286.0/63371: 24% mana clearcasting, presence_of_mind(3)
1:25.732 aoe p arcane_explosion Fluffy_Pillow 16943.8/63371: 27% mana arcane_charge, presence_of_mind(3)
1:27.040 aoe p arcane_explosion Fluffy_Pillow 13601.6/63371: 21% mana arcane_charge(2), presence_of_mind(3)
1:28.346 aoe p arcane_explosion Fluffy_Pillow 10256.8/63371: 16% mana arcane_charge(3), presence_of_mind(3)
1:29.653 aoe q arcane_barrage Fluffy_Pillow 6913.4/63371: 11% mana arcane_charge(4), presence_of_mind(3)
1:30.958 aoe p arcane_explosion Fluffy_Pillow 11102.2/63371: 18% mana presence_of_mind(3)
1:32.266 aoe p arcane_explosion Fluffy_Pillow 7760.0/63371: 12% mana arcane_charge, presence_of_mind(3)
1:33.573 aoe p arcane_explosion Fluffy_Pillow 4416.6/63371: 7% mana arcane_charge(2), clearcasting, presence_of_mind(3)
1:34.881 aoe p arcane_explosion Fluffy_Pillow 6074.3/63371: 10% mana arcane_charge(3), presence_of_mind(3)
1:36.187 aoe q arcane_barrage Fluffy_Pillow 2729.6/63371: 4% mana arcane_charge(4), presence_of_mind(3)
1:37.494 aoe o arcane_orb Fluffy_Pillow 6921.0/63371: 11% mana presence_of_mind(3)
1:38.799 aoe q arcane_barrage Fluffy_Pillow 8075.0/63371: 13% mana arcane_charge(4), presence_of_mind(3)
1:40.105 aoe p arcane_explosion Fluffy_Pillow 12265.1/63371: 19% mana presence_of_mind(3)
1:41.410 aoe p arcane_explosion Fluffy_Pillow 8919.1/63371: 14% mana arcane_charge, presence_of_mind(3)
1:42.718 aoe p arcane_explosion Fluffy_Pillow 5576.9/63371: 9% mana arcane_charge(2), clearcasting, presence_of_mind(3)
1:44.026 aoe p arcane_explosion Fluffy_Pillow 7234.7/63371: 11% mana arcane_charge(3), presence_of_mind(3)
1:45.332 aoe q arcane_barrage Fluffy_Pillow 3890.0/63371: 6% mana arcane_charge(4), clearcasting, presence_of_mind(3)
1:46.638 aoe p arcane_explosion Fluffy_Pillow 8080.1/63371: 13% mana clearcasting, presence_of_mind(3)
1:47.945 aoe p arcane_explosion Fluffy_Pillow 9736.6/63371: 15% mana arcane_charge, presence_of_mind(3)
1:49.252 aoe p arcane_explosion Fluffy_Pillow 6393.1/63371: 10% mana arcane_charge(2), clearcasting, presence_of_mind(3)
1:50.559 aoe p arcane_explosion Fluffy_Pillow 8049.7/63371: 13% mana arcane_charge(3), presence_of_mind(3)
1:51.864 aoe q arcane_barrage Fluffy_Pillow 4703.7/63371: 7% mana arcane_charge(4), presence_of_mind(3)
1:53.169 aoe k touch_of_the_magi Fluffy_Pillow 8892.5/63371: 14% mana presence_of_mind(3)
1:54.475 aoe m rune_of_power Fluffy_Pillow 8047.8/63371: 13% mana arcane_charge(4), clearcasting, presence_of_mind(3)
1:55.779 aoe q arcane_barrage Fluffy_Pillow 9700.5/63371: 15% mana arcane_charge(4), clearcasting, presence_of_mind(3), rune_of_power
1:57.086 aoe p arcane_explosion Fluffy_Pillow 13891.9/63371: 22% mana clearcasting, presence_of_mind(3), rune_of_power
1:58.393 aoe p arcane_explosion Fluffy_Pillow 15548.4/63371: 25% mana arcane_charge, presence_of_mind(3), rune_of_power
1:59.698 aoe p arcane_explosion Fluffy_Pillow 12202.4/63371: 19% mana arcane_charge(2), presence_of_mind(3), rune_of_power
2:01.003 aoe p arcane_explosion Fluffy_Pillow 8856.4/63371: 14% mana arcane_charge(3), presence_of_mind(3), rune_of_power
2:02.309 aoe q arcane_barrage Fluffy_Pillow 5511.7/63371: 9% mana arcane_charge(4), presence_of_mind(3), rune_of_power
2:03.616 aoe o arcane_orb Fluffy_Pillow 9703.1/63371: 15% mana presence_of_mind(3), rune_of_power
2:04.923 aoe q arcane_barrage Fluffy_Pillow 10859.6/63371: 17% mana arcane_charge(4), presence_of_mind(3), rune_of_power
2:06.228 aoe p arcane_explosion Fluffy_Pillow 15048.4/63371: 24% mana presence_of_mind(3), rune_of_power
2:07.533 aoe p arcane_explosion Fluffy_Pillow 11702.4/63371: 18% mana arcane_charge, presence_of_mind(3), rune_of_power
2:08.840 aoe p arcane_explosion Fluffy_Pillow 8359.0/63371: 13% mana arcane_charge(2), clearcasting, presence_of_mind(3)
2:10.147 aoe p arcane_explosion Fluffy_Pillow 10015.5/63371: 16% mana arcane_charge(3), presence_of_mind(3)
2:11.455 aoe l arcane_power Fluffy_Pillow 6673.3/63371: 11% mana arcane_charge(4), clearcasting, presence_of_mind(3)
2:11.455 aoe q arcane_barrage Fluffy_Pillow 6673.3/63371: 11% mana arcane_charge(4), arcane_power, clearcasting, presence_of_mind(3), rune_of_power
2:12.762 aoe p arcane_explosion Fluffy_Pillow 10864.7/63371: 17% mana arcane_power, clearcasting, presence_of_mind(3), rune_of_power
2:14.068 aoe p arcane_explosion Fluffy_Pillow 12519.9/63371: 20% mana arcane_charge, arcane_power, presence_of_mind(3), rune_of_power
2:15.374 aoe p arcane_explosion Fluffy_Pillow 11675.2/63371: 18% mana arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power
2:16.680 aoe p arcane_explosion Fluffy_Pillow 10830.5/63371: 17% mana arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power
2:17.985 aoe q arcane_barrage Fluffy_Pillow 9984.4/63371: 16% mana arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power
2:19.292 aoe p arcane_explosion Fluffy_Pillow 14175.8/63371: 22% mana arcane_power, presence_of_mind(3), rune_of_power
2:20.597 aoe p arcane_explosion Fluffy_Pillow 13329.8/63371: 21% mana arcane_charge, arcane_power, presence_of_mind(3), rune_of_power
2:21.905 aoe p arcane_explosion Fluffy_Pillow 12487.6/63371: 20% mana arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power
2:23.211 aoe p arcane_explosion Fluffy_Pillow 11642.9/63371: 18% mana arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power
2:24.518 shared_cds s use_mana_gem Necrolord_Emeni 10799.4/63371: 17% mana arcane_charge(4), arcane_power, presence_of_mind(3)
2:24.518 aoe q arcane_barrage Fluffy_Pillow 17136.6/63371: 27% mana arcane_charge(4), arcane_power, presence_of_mind(3)
2:25.825 aoe o arcane_orb Fluffy_Pillow 21327.9/63371: 34% mana arcane_power, presence_of_mind(3)
2:27.130 aoe q arcane_barrage Fluffy_Pillow 22731.9/63371: 36% mana arcane_charge(4), presence_of_mind(3)
2:28.436 aoe p arcane_explosion Fluffy_Pillow 26922.1/63371: 42% mana presence_of_mind(3)
2:29.743 aoe p arcane_explosion Fluffy_Pillow 23578.6/63371: 37% mana arcane_charge, presence_of_mind(3)
2:31.051 aoe p arcane_explosion Fluffy_Pillow 20236.4/63371: 32% mana arcane_charge(2), clearcasting, presence_of_mind(3)
2:32.358 aoe p arcane_explosion Fluffy_Pillow 21892.9/63371: 35% mana arcane_charge(3), presence_of_mind(3)
2:33.664 aoe q arcane_barrage Fluffy_Pillow 18548.2/63371: 29% mana arcane_charge(4), clearcasting, presence_of_mind(3)
2:34.970 aoe p arcane_explosion Fluffy_Pillow 22738.3/63371: 36% mana clearcasting, presence_of_mind(3)
2:36.278 aoe p arcane_explosion Fluffy_Pillow 24396.1/63371: 38% mana arcane_charge, presence_of_mind(3)
2:37.584 aoe p arcane_explosion Fluffy_Pillow 21051.4/63371: 33% mana arcane_charge(2), presence_of_mind(3)
2:38.890 aoe p arcane_explosion Fluffy_Pillow 17706.6/63371: 28% mana arcane_charge(3), clearcasting, presence_of_mind(3)
2:40.196 aoe q arcane_barrage Fluffy_Pillow 19361.9/63371: 31% mana arcane_charge(4), presence_of_mind(3)
2:41.503 aoe k touch_of_the_magi Fluffy_Pillow 23553.3/63371: 37% mana presence_of_mind(3)
2:42.809 aoe m rune_of_power Fluffy_Pillow 22708.5/63371: 36% mana arcane_charge(4), presence_of_mind(3)
2:44.115 aoe q arcane_barrage Fluffy_Pillow 24363.8/63371: 38% mana arcane_charge(4), presence_of_mind(3), rune_of_power
2:45.421 aoe p arcane_explosion Fluffy_Pillow 28553.9/63371: 45% mana presence_of_mind(3), rune_of_power
2:46.729 aoe p arcane_explosion Fluffy_Pillow 25211.7/63371: 40% mana arcane_charge, presence_of_mind(3), rune_of_power
2:48.036 aoe p arcane_explosion Fluffy_Pillow 21868.2/63371: 35% mana arcane_charge(2), presence_of_mind(3), rune_of_power
2:49.344 aoe p arcane_explosion Fluffy_Pillow 18526.0/63371: 29% mana arcane_charge(3), presence_of_mind(3), rune_of_power
2:50.651 aoe q arcane_barrage Fluffy_Pillow 15182.6/63371: 24% mana arcane_charge(4), clearcasting, presence_of_mind(3), rune_of_power
2:51.958 aoe o arcane_orb Fluffy_Pillow 19373.9/63371: 31% mana clearcasting, presence_of_mind(3), rune_of_power
2:53.264 aoe q arcane_barrage Fluffy_Pillow 20529.2/63371: 32% mana arcane_charge(4), clearcasting, presence_of_mind(3), rune_of_power
2:54.571 aoe p arcane_explosion Fluffy_Pillow 24720.6/63371: 39% mana clearcasting, presence_of_mind(3), rune_of_power
2:55.880 aoe p arcane_explosion Fluffy_Pillow 26379.7/63371: 42% mana arcane_charge, presence_of_mind(3), rune_of_power
2:57.187 aoe p arcane_explosion Fluffy_Pillow 23036.2/63371: 36% mana arcane_charge(2), clearcasting, presence_of_mind(3)
2:58.493 aoe p arcane_explosion Fluffy_Pillow 24691.4/63371: 39% mana arcane_charge(3), presence_of_mind(3)
2:59.799 aoe q arcane_barrage Fluffy_Pillow 21346.7/63371: 34% mana arcane_charge(4), presence_of_mind(3)
3:01.107 aoe p arcane_explosion Fluffy_Pillow 25539.4/63371: 40% mana presence_of_mind(3)
3:02.412 aoe p arcane_explosion Fluffy_Pillow 22193.4/63371: 35% mana arcane_charge, presence_of_mind(3)
3:03.718 aoe p arcane_explosion Fluffy_Pillow 18848.6/63371: 30% mana arcane_charge(2), presence_of_mind(3)
3:05.025 aoe p arcane_explosion Fluffy_Pillow 15505.1/63371: 24% mana arcane_charge(3), clearcasting, presence_of_mind(3)
3:06.332 aoe q arcane_barrage Fluffy_Pillow 17161.7/63371: 27% mana arcane_charge(4), presence_of_mind(3)
3:07.639 aoe p arcane_explosion Fluffy_Pillow 21353.1/63371: 34% mana presence_of_mind(3)
3:08.946 aoe p arcane_explosion Fluffy_Pillow 18009.6/63371: 28% mana arcane_charge, presence_of_mind(3)
3:10.254 aoe p arcane_explosion Fluffy_Pillow 14667.4/63371: 23% mana arcane_charge(2), presence_of_mind(3)
3:11.560 aoe p arcane_explosion Fluffy_Pillow 11322.6/63371: 18% mana arcane_charge(3), presence_of_mind(3)
3:12.866 aoe q arcane_barrage Fluffy_Pillow 7977.9/63371: 13% mana arcane_charge(4), presence_of_mind(3)
3:14.172 aoe o arcane_orb Fluffy_Pillow 12168.0/63371: 19% mana presence_of_mind(3)
3:15.478 aoe q arcane_barrage Fluffy_Pillow 13323.3/63371: 21% mana arcane_charge(4), presence_of_mind(3)
3:16.785 aoe p arcane_explosion Fluffy_Pillow 17514.7/63371: 28% mana presence_of_mind(3)
3:18.091 aoe p arcane_explosion Fluffy_Pillow 14169.9/63371: 22% mana arcane_charge, presence_of_mind(3)
3:19.398 aoe p arcane_explosion Fluffy_Pillow 10826.5/63371: 17% mana arcane_charge(2), presence_of_mind(3)
3:20.705 aoe p arcane_explosion Fluffy_Pillow 7483.0/63371: 12% mana arcane_charge(3), presence_of_mind(3)
3:22.012 aoe q arcane_barrage Fluffy_Pillow 4139.5/63371: 7% mana arcane_charge(4), presence_of_mind(3)
3:23.319 aoe p arcane_explosion Fluffy_Pillow 8330.9/63371: 13% mana presence_of_mind(3)
3:24.626 aoe r evocation Necrolord_Emeni 4987.4/63371: 8% mana arcane_charge, presence_of_mind(3)
3:28.970 aoe k touch_of_the_magi Fluffy_Pillow 58832.1/63371: 93% mana arcane_charge, presence_of_mind(3)
3:30.277 aoe m rune_of_power Fluffy_Pillow 57988.6/63371: 92% mana arcane_charge(4), presence_of_mind(3)
3:31.583 aoe q arcane_barrage Fluffy_Pillow 59643.9/63371: 94% mana arcane_charge(4), presence_of_mind(3), rune_of_power
3:32.888 aoe p arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana presence_of_mind(3), rune_of_power
3:34.194 aoe p arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge, presence_of_mind(3), rune_of_power
3:35.501 aoe p arcane_explosion Fluffy_Pillow 56683.2/63371: 89% mana arcane_charge(2), presence_of_mind(3), rune_of_power
3:36.806 aoe p arcane_explosion Fluffy_Pillow 53337.2/63371: 84% mana arcane_charge(3), clearcasting, presence_of_mind(3), rune_of_power
3:38.114 aoe q arcane_barrage Fluffy_Pillow 54995.0/63371: 87% mana arcane_charge(4), presence_of_mind(3), rune_of_power
3:39.420 aoe o arcane_orb Fluffy_Pillow 59185.1/63371: 93% mana presence_of_mind(3), rune_of_power
3:40.726 aoe q arcane_barrage Fluffy_Pillow 60340.4/63371: 95% mana arcane_charge(4), presence_of_mind(3), rune_of_power
3:42.031 aoe p arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana presence_of_mind(3), rune_of_power
3:43.336 aoe p arcane_explosion Fluffy_Pillow 60025.4/63371: 95% mana arcane_charge, presence_of_mind(3), rune_of_power
3:44.642 aoe p arcane_explosion Fluffy_Pillow 56680.7/63371: 89% mana arcane_charge(2), presence_of_mind(3)
3:45.950 aoe p arcane_explosion Fluffy_Pillow 53338.5/63371: 84% mana arcane_charge(3), presence_of_mind(3)
3:47.257 aoe q arcane_barrage Fluffy_Pillow 49995.0/63371: 79% mana arcane_charge(4), presence_of_mind(3)
3:48.562 aoe p arcane_explosion Fluffy_Pillow 54183.9/63371: 86% mana presence_of_mind(3)
3:49.869 aoe p arcane_explosion Fluffy_Pillow 50840.4/63371: 80% mana arcane_charge, presence_of_mind(3)
3:51.174 aoe p arcane_explosion Fluffy_Pillow 47494.4/63371: 75% mana arcane_charge(2), presence_of_mind(3)
3:52.481 aoe p arcane_explosion Fluffy_Pillow 44150.9/63371: 70% mana arcane_charge(3), presence_of_mind(3)
3:53.787 aoe q arcane_barrage Fluffy_Pillow 40806.2/63371: 64% mana arcane_charge(4), clearcasting, presence_of_mind(3)
3:55.093 aoe p arcane_explosion Fluffy_Pillow 44996.3/63371: 71% mana clearcasting, presence_of_mind(3)
3:56.399 aoe p arcane_explosion Fluffy_Pillow 46651.6/63371: 74% mana arcane_charge, presence_of_mind(3)
3:57.707 aoe p arcane_explosion Fluffy_Pillow 43309.4/63371: 68% mana arcane_charge(2), presence_of_mind(3)
3:59.014 aoe p arcane_explosion Fluffy_Pillow 39965.9/63371: 63% mana arcane_charge(3), presence_of_mind(3)
4:00.320 aoe q arcane_barrage Fluffy_Pillow 36621.1/63371: 58% mana arcane_charge(4), presence_of_mind(3)
4:01.626 aoe o arcane_orb Fluffy_Pillow 40811.3/63371: 64% mana presence_of_mind(3)
4:02.932 aoe q arcane_barrage Fluffy_Pillow 41966.5/63371: 66% mana arcane_charge(4), presence_of_mind(3)
4:04.240 aoe p arcane_explosion Fluffy_Pillow 46159.2/63371: 73% mana presence_of_mind(3)
4:05.545 aoe p arcane_explosion Fluffy_Pillow 42813.2/63371: 68% mana arcane_charge, presence_of_mind(3)
4:06.853 aoe p arcane_explosion Fluffy_Pillow 39471.0/63371: 62% mana arcane_charge(2), presence_of_mind(3)
4:08.160 aoe p arcane_explosion Fluffy_Pillow 36127.5/63371: 57% mana arcane_charge(3), clearcasting, presence_of_mind(3)
4:09.466 aoe q arcane_barrage Fluffy_Pillow 37782.8/63371: 60% mana arcane_charge(4), presence_of_mind(3)
4:10.774 aoe p arcane_explosion Fluffy_Pillow 41975.4/63371: 66% mana presence_of_mind(3)
4:12.080 aoe p arcane_explosion Fluffy_Pillow 38630.7/63371: 61% mana arcane_charge, presence_of_mind(3)
4:13.387 aoe p arcane_explosion Fluffy_Pillow 35287.2/63371: 56% mana arcane_charge(2), presence_of_mind(3)
4:14.693 aoe p arcane_explosion Fluffy_Pillow 31942.5/63371: 50% mana arcane_charge(3), presence_of_mind(3)
4:15.998 aoe q arcane_barrage Fluffy_Pillow 28596.5/63371: 45% mana arcane_charge(4), clearcasting, presence_of_mind(3)
4:17.305 aoe j deathborne Fluffy_Pillow 32787.8/63371: 52% mana clearcasting, presence_of_mind(3)
4:18.610 aoe k touch_of_the_magi Fluffy_Pillow 31941.8/63371: 50% mana clearcasting, presence_of_mind(3), deathborne, lead_by_example
4:19.915 aoe l arcane_power Fluffy_Pillow 31095.8/63371: 49% mana arcane_charge(4), clearcasting, presence_of_mind(3), deathborne, lead_by_example
4:19.915 shared_cds u berserking Fluffy_Pillow 31095.8/63371: 49% mana arcane_charge(4), arcane_power, clearcasting, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:19.915 aoe q arcane_barrage Fluffy_Pillow 31095.8/63371: 49% mana berserking, arcane_charge(4), arcane_power, clearcasting, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:21.101 aoe p arcane_explosion Fluffy_Pillow 35133.9/63371: 55% mana berserking, arcane_power, clearcasting, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:22.290 aoe p arcane_explosion Fluffy_Pillow 36640.8/63371: 58% mana berserking, arcane_charge, arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:23.478 aoe p arcane_explosion Fluffy_Pillow 35646.5/63371: 56% mana berserking, arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:24.666 shared_cds s use_mana_gem Necrolord_Emeni 34652.2/63371: 55% mana berserking, arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:24.666 aoe p arcane_explosion Fluffy_Pillow 40989.4/63371: 65% mana berserking, arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:25.854 aoe q arcane_barrage Fluffy_Pillow 39995.1/63371: 63% mana berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:27.042 aoe o arcane_orb Fluffy_Pillow 44035.7/63371: 69% mana berserking, arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:28.229 aoe q arcane_barrage Fluffy_Pillow 45290.1/63371: 71% mana berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:29.417 aoe p arcane_explosion Fluffy_Pillow 49330.7/63371: 78% mana berserking, arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:30.605 aoe p arcane_explosion Fluffy_Pillow 48336.4/63371: 76% mana berserking, arcane_charge, arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:31.794 aoe p arcane_explosion Fluffy_Pillow 47343.3/63371: 75% mana berserking, arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:32.982 aoe p arcane_explosion Fluffy_Pillow 46349.0/63371: 73% mana arcane_charge(3), arcane_power, presence_of_mind(3), deathborne, lead_by_example
4:34.289 aoe m rune_of_power Fluffy_Pillow 45505.6/63371: 72% mana arcane_charge(4), arcane_power, presence_of_mind(3), deathborne, lead_by_example
4:35.597 aoe q arcane_barrage Fluffy_Pillow 47163.4/63371: 74% mana arcane_charge(4), presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:36.904 aoe p arcane_explosion Fluffy_Pillow 51354.8/63371: 81% mana presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:38.210 aoe p arcane_explosion Fluffy_Pillow 48010.0/63371: 76% mana arcane_charge, presence_of_mind(3), rune_of_power, deathborne, lead_by_example
4:39.517 aoe p arcane_explosion Fluffy_Pillow 44666.5/63371: 70% mana arcane_charge(2), presence_of_mind(3), rune_of_power, lead_by_example
4:40.824 aoe p arcane_explosion Fluffy_Pillow 41323.1/63371: 65% mana arcane_charge(3), presence_of_mind(3), rune_of_power, lead_by_example
4:42.131 aoe q arcane_barrage Fluffy_Pillow 37979.6/63371: 60% mana arcane_charge(4), presence_of_mind(3), rune_of_power, lead_by_example

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Necrolord_Emeni"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=necrolord
soulbind=342156//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Necrolord_Marileth : 16331 dps, 4487 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16330.5 16330.5 26.9 / 0.164% 1626.6 / 10.0% 8.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
2046.6 1942.5 Mana 0.00% 49.6 100.0% 100%
Talents
Necrolord

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Necrolord_Marileth 16331
Arcane Barrage 5741 35.2% 56.9 5.28sec 30336 24316 Direct 284.3 5091 10213 6076 19.2%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 56.93 284.28 0.00 0.00 1.2476 0.0000 1727074.70 1727074.70 0.00% 24316.09 24316.09
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 229.59 175 288 5091.03 2082 27654 5083.76 4596 5616 1168432 1168432 0.00%
crit 19.24% 54.70 28 82 10213.30 4164 55308 10200.62 7651 13401 558643 558643 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [q]:56.93
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 404 2.5% 36.4 7.74sec 3327 0 Direct 182.2 558 1113 666 19.4%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 36.45 182.24 0.00 0.00 0.0000 0.0000 121258.60 121258.60 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.60% 146.89 104 191 557.75 443 731 557.06 518 585 81903 81903 0.00%
crit 19.40% 35.36 15 57 1113.50 886 1462 1111.93 948 1337 39356 39356 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 7766 47.5% 153.9 1.92sec 15163 12206 Direct 769.5 2542 5090 3033 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 153.91 769.55 0.00 0.00 1.2423 0.0000 2333803.75 2333803.75 0.00% 12205.90 12205.90
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 621.29 479 764 2542.43 1958 4523 2541.54 2432 2644 1579247 1579247 0.00%
crit 19.27% 148.25 101 203 5090.00 3916 9045 5089.71 4700 5547 754557 754557 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [p]:153.90
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1381) 0.0% (8.4%) 13.0 23.71sec 31805 25512

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.04 0.00 0.00 0.00 1.2468 0.0000 0.00 0.00 0.00% 25511.84 25511.84

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [o]:13.03
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1381 8.4% 65.1 23.71sec 6370 0 Direct 65.1 5334 10660 6372 19.5%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 65.09 65.09 0.00 0.00 0.0000 0.0000 414592.94 414592.94 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.52% 52.41 35 68 5334.14 3869 8938 5332.07 4738 5886 279428 279428 0.00%
crit 19.48% 12.68 3 24 10659.54 7739 17876 10662.99 8181 14065 135165 135165 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (68) 0.0% (0.4%) 14.7 1.77sec 1382 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.67 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 68 0.4% 14.7 1.77sec 1382 0 Direct 14.7 1164 2327 1382 18.8%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.67 14.67 0.00 0.00 0.0000 0.0000 20280.65 20280.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.19% 11.91 5 19 1163.53 1164 1164 1163.53 1164 1164 13860 13860 0.00%
crit 18.81% 2.76 0 9 2327.06 2327 2327 2199.05 0 2327 6421 6421 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1776 19.8%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1774.48 1774.48 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.16% 0.80 0 1 1480.68 1481 1481 1186.87 0 1481 1187 1187 0.00%
crit 19.84% 0.20 0 1 2961.35 2961 2961 587.62 0 2961 588 588 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.1%) 1.0 0.00sec 5785 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 145  / 20 0.1% 90.0 1.29sec 64 49 Direct 90.0 54 108 64 19.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5785.47 5785.47 0.00% 49.12 49.12
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.82% 72.74 60 85 53.92 43 60 53.92 53 56 3922 3922 0.00%
crit 19.18% 17.26 5 30 107.92 86 120 107.97 95 120 1863 1863 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (946) 0.0% (5.8%) 6.1 52.63sec 46309 36826

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.14 0.00 0.00 0.00 1.2576 0.0000 0.00 0.00 0.00% 36825.56 36825.56

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.16
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 946 5.8% 6.1 52.57sec 46309 0 Direct 30.6 9306 0 9306 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.14 30.58 0.00 0.00 0.0000 0.0000 284403.76 284403.76 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 30.58 25 35 9306.07 2143 54902 9293.79 6452 13452 284404 284404 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:29770.56
  • base_dd_max:29770.56
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Necrolord_Marileth
Arcane Power 2.8 128.50sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.84
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 256.91sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [u]:1.84
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Deathborne 1.8 256.98sec

Stats Details: Deathborne

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.84 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathborne

  • id:324220
  • school:shadow
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:324220
  • name:Deathborne
  • school:shadow
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.

Action Priority List

    aoe
    [j]:1.86
  • if_expr:cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
Evocation 1.2 174.71sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.17 0.00 6.91 0.00 4.2966 0.7217 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Marileth
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [r]:1.17
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Marileth
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Marileth
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [t]:1.00
  • if_expr:buff.arcane_power.up
Presence of Mind 1.0 0.00sec

Stats Details: Presence Of Mind

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Presence Of Mind

  • id:205025
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:60.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:205025
  • name:Presence of Mind
  • school:arcane
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.

Action Priority List

    aoe
    [n]:1.00
  • if_expr:buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
Rune of Power 6.0 50.68sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.02 0.00 0.00 0.00 1.2566 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:6.03
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 123.05sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Necrolord_Marileth
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [s]:2.76
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 57.7 180.5 5.2sec 1.3sec 3.8sec 73.52% 0.00% 26.9 (27.0) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.9s

Stack Uptimes

  • arcane_charge_1:19.01%
  • arcane_charge_2:16.32%
  • arcane_charge_3:16.67%
  • arcane_charge_4:21.52%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 128.5sec 128.5sec 14.7sec 13.88% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.4s / 135.0s
  • trigger_min/max:120.4s / 135.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:13.88%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 257.0sec 257.0sec 11.7sec 7.11% 23.66% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:246.2s / 263.2s
  • trigger_min/max:246.2s / 263.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:7.11%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.5 0.1 11.9sec 11.8sec 2.0sec 15.89% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:15.79%
  • clearcasting_2:0.11%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Deathborne 1.8 0.0 257.0sec 257.0sec 19.2sec 11.68% 0.00% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_deathborne
  • max_stacks:1
  • base duration:20.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:247.2s / 262.9s
  • trigger_min/max:247.2s / 262.9s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 20.0s

Stack Uptimes

  • deathborne_1:11.68%

Spelldata

  • id:324220
  • name:Deathborne
  • tooltip:Transformed into a powerful skeletal mage, greatly enhancing your Frostbolt, Fireball, and Arcane Blast and increasing your spell damage by {$s2=10}%.
  • description:Transform into a powerful skeletal mage for {$d=20 seconds}. While in the form of a skeletal mage, your Frostbolt, Fireball, and Arcane Blast hit up to {$s4=2} enemies near your target and your spell damage is increased by {$s2=10}%.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Evocation 1.2 0.0 169.4sec 169.4sec 4.3sec 1.66% 0.00% 4.6 (4.6) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:94.5s / 256.5s
  • trigger_min/max:94.5s / 256.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 4.3s

Stack Uptimes

  • evocation_1:1.66%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.43% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.43%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Presence of Mind 1.0 0.0 0.0sec 0.0sec 293.8sec 97.68% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_presence_of_mind
  • max_stacks:3
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:233.2s / 353.1s

Stack Uptimes

  • presence_of_mind_3:97.68%

Spelldata

  • id:205025
  • name:Presence of Mind
  • tooltip:Arcane Blast is instant cast.
  • description:Causes your next $n Arcane Blasts to be instant cast.
  • max_stacks:0
  • duration:-0.00
  • cooldown:60.00
  • default_chance:100.00%
Rune of Power 8.9 0.0 35.2sec 35.2sec 11.8sec 34.72% 0.00% 0.0 (0.0) 8.5

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.5s / 55.3s
  • trigger_min/max:13.5s / 55.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:34.72%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.78% 0.51% 6.47% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 300.7s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.660120.091239.937
Evocation144.5114.500335.517213.039129.379336.890
Rune of Power6.6300.03823.38741.14124.41755.997
Touch of the Magi5.4990.00021.03535.08723.11155.214
Arcane Power6.3210.37514.97718.2492.71925.557
Arcane Barrage2.7840.0029.585159.571126.008193.183
Arcane Orb3.6720.00010.48548.28128.96263.776
Deathborne34.7120.00081.64074.49258.78981.640
Presence of Mind6.8856.8776.8946.8856.8776.894

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Necrolord_Marileth
mana_regen Mana 512.90 372077.01 63.70% 725.44 8316.88 2.19%
Evocation Mana 55.50 55804.26 9.55% 1005.43 0.00 0.00%
Mana Gem Mana 2.76 17479.24 2.99% 6337.14 0.00 0.00%
Arcane Barrage Mana 56.93 138780.61 23.76% 2437.85 5522.39 3.83%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1942.52 2046.62 13822.8 32074.2 263.0 63371.4
Usage Type Count Total Avg RPE APR
Necrolord_Marileth
arcane_explosion Mana 153.9 588539.7 3824.1 3823.9 4.0
arcane_orb Mana 13.0 5849.9 448.8 448.8 70.9
deathborne Mana 1.8 4618.0 2500.0 2503.3 0.0
touch_of_the_magi Mana 6.1 15348.2 2500.0 2499.1 18.5

Statistics & Data Analysis

Fight Length
Necrolord_Marileth Fight Length
Count 1018
Mean 300.66
Minimum 240.09
Maximum 359.94
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
Necrolord_Marileth Damage Per Second
Count 1018
Mean 16330.54
Minimum 15119.05
Maximum 17655.63
Spread ( max - min ) 2536.58
Range [ ( max - min ) / 2 * 100% ] 7.77%
Standard Deviation 437.2212
5th Percentile 15625.22
95th Percentile 17049.91
( 95th Percentile - 5th Percentile ) 1424.69
Mean Distribution
Standard Deviation 13.7034
95.00% Confidence Interval ( 16303.68 - 16357.40 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2754
0.1 Scale Factor Error with Delta=300 1632
0.05 Scale Factor Error with Delta=300 6528
0.01 Scale Factor Error with Delta=300 163188
Priority Target DPS
Necrolord_Marileth Priority Target Damage Per Second
Count 1018
Mean 4486.52
Minimum 3996.48
Maximum 5131.26
Spread ( max - min ) 1134.78
Range [ ( max - min ) / 2 * 100% ] 12.65%
Standard Deviation 181.1746
5th Percentile 4211.44
95th Percentile 4806.94
( 95th Percentile - 5th Percentile ) 595.50
Mean Distribution
Standard Deviation 5.6784
95.00% Confidence Interval ( 4475.39 - 4497.65 )
Normalized 95.00% Confidence Interval ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 63
0.1% Error 6265
0.1 Scale Factor Error with Delta=300 281
0.05 Scale Factor Error with Delta=300 1121
0.01 Scale Factor Error with Delta=300 28021
DPS(e)
Necrolord_Marileth Damage Per Second (Effective)
Count 1018
Mean 16330.54
Minimum 15119.05
Maximum 17655.63
Spread ( max - min ) 2536.58
Range [ ( max - min ) / 2 * 100% ] 7.77%
Damage
Necrolord_Marileth Damage
Count 1018
Mean 4903188.89
Minimum 3748751.88
Maximum 5928748.02
Spread ( max - min ) 2179996.14
Range [ ( max - min ) / 2 * 100% ] 22.23%
DTPS
Necrolord_Marileth Damage Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Necrolord_Marileth Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Necrolord_Marileth Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Necrolord_Marileth Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Necrolord_Marileth Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Necrolord_Marileth Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Necrolord_MarilethTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Necrolord_Marileth Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 1.86 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.16 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.84 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 6.03 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
n 1.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
o 13.03 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
p 153.90 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
q 56.93 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
r 1.17 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
s 2.76 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
t 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
u 1.84 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjkltuqoqppnppqppppqppppmqppsppqoqppppqppppqppppqppppqoqppppqppppqkmqppppqoqppppqppppqppppqoqppppqppppqkmqppppqoqpppplqppppqpppspqoqppppqppppqkmqppppqoqppppqppppqppppqoqppppqppprpqkmqoqppppqppppqppppqoqppppqppppqppppqjskluqoqppppqppppmqp

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Necrolord_Marileth 63371.4/63371: 100% mana
Pre precombat R food Necrolord_Marileth 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j deathborne Fluffy_Pillow 62371.4/63371: 98% mana
0:01.308 aoe k touch_of_the_magi Fluffy_Pillow 60879.0/63371: 96% mana bloodlust, deathborne
0:02.316 aoe l arcane_power Fluffy_Pillow 59656.6/63371: 94% mana bloodlust, arcane_charge(4), deathborne
0:02.316 shared_cds t potion Fluffy_Pillow 59656.6/63371: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne
0:02.316 shared_cds u berserking Fluffy_Pillow 59656.6/63371: 94% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:02.316 aoe q arcane_barrage Fluffy_Pillow 59656.6/63371: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:03.231 aoe o arcane_orb Fluffy_Pillow 63351.2/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:04.146 aoe q arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:05.062 aoe p arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:05.974 aoe p arcane_explosion Fluffy_Pillow 62027.3/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:06.889 aoe n presence_of_mind Fluffy_Pillow 60687.0/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, deathborne, potion_of_deathly_fixation
0:06.889 aoe p arcane_explosion Fluffy_Pillow 60687.0/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:07.804 aoe p arcane_explosion Fluffy_Pillow 59346.7/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:08.717 aoe q arcane_barrage Fluffy_Pillow 58003.9/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:09.632 aoe p arcane_explosion Fluffy_Pillow 61698.4/63371: 97% mana bloodlust, berserking, arcane_power, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:10.547 aoe p arcane_explosion Fluffy_Pillow 60358.1/63371: 95% mana bloodlust, berserking, arcane_charge, arcane_power, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:11.461 aoe p arcane_explosion Fluffy_Pillow 59016.6/63371: 93% mana bloodlust, berserking, arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:12.379 aoe p arcane_explosion Fluffy_Pillow 57680.1/63371: 91% mana bloodlust, berserking, arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:13.293 aoe q arcane_barrage Fluffy_Pillow 56338.5/63371: 89% mana bloodlust, berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:14.207 aoe p arcane_explosion Fluffy_Pillow 60031.8/63371: 95% mana bloodlust, berserking, arcane_power, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:15.121 aoe p arcane_explosion Fluffy_Pillow 58690.2/63371: 93% mana bloodlust, arcane_charge, arcane_power, presence_of_mind(3), deathborne, potion_of_deathly_fixation
0:16.128 aoe p arcane_explosion Fluffy_Pillow 57466.5/63371: 91% mana bloodlust, arcane_charge(2), arcane_power, presence_of_mind(3), deathborne, potion_of_deathly_fixation
0:17.133 aoe p arcane_explosion Fluffy_Pillow 56240.3/63371: 89% mana bloodlust, arcane_charge(3), arcane_power, presence_of_mind(3), deathborne, potion_of_deathly_fixation
0:18.139 aoe m rune_of_power Fluffy_Pillow 55015.3/63371: 87% mana bloodlust, arcane_charge(4), presence_of_mind(3), deathborne, potion_of_deathly_fixation
0:19.146 aoe q arcane_barrage Fluffy_Pillow 56291.6/63371: 89% mana bloodlust, arcane_charge(4), presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:20.152 aoe p arcane_explosion Fluffy_Pillow 60101.5/63371: 95% mana bloodlust, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:21.159 aoe p arcane_explosion Fluffy_Pillow 56377.8/63371: 89% mana bloodlust, arcane_charge, presence_of_mind(3), rune_of_power, deathborne, potion_of_deathly_fixation
0:22.167 shared_cds s use_mana_gem Necrolord_Marileth 52655.4/63371: 83% mana bloodlust, arcane_charge(2), presence_of_mind(3), rune_of_power, potion_of_deathly_fixation
0:22.167 aoe p arcane_explosion Fluffy_Pillow 58992.5/63371: 93% mana bloodlust, arcane_charge(2), presence_of_mind(3), rune_of_power, potion_of_deathly_fixation
0:23.173 aoe p arcane_explosion Fluffy_Pillow 55267.5/63371: 87% mana bloodlust, arcane_charge(3), presence_of_mind(3), rune_of_power, potion_of_deathly_fixation
0:24.179 aoe q arcane_barrage Fluffy_Pillow 51542.6/63371: 81% mana bloodlust, arcane_charge(4), clearcasting, presence_of_mind(3), rune_of_power, potion_of_deathly_fixation
0:25.186 aoe o arcane_orb Fluffy_Pillow 55353.7/63371: 87% mana bloodlust, clearcasting, presence_of_mind(3), rune_of_power, potion_of_deathly_fixation
0:26.191 aoe q arcane_barrage Fluffy_Pillow 56127.5/63371: 89% mana bloodlust, arcane_charge(4), clearcasting, presence_of_mind(3), rune_of_power, potion_of_deathly_fixation
0:27.196 aoe p arcane_explosion Fluffy_Pillow 59936.1/63371: 95% mana bloodlust, clearcasting, presence_of_mind(3), rune_of_power, potion_of_deathly_fixation
0:28.201 aoe p arcane_explosion Fluffy_Pillow 61209.9/63371: 97% mana bloodlust, arcane_charge, presence_of_mind(3), rune_of_power
0:29.206 aoe p arcane_explosion Fluffy_Pillow 57483.7/63371: 91% mana bloodlust, arcane_charge(2), clearcasting, presence_of_mind(3), rune_of_power
0:30.213 aoe p arcane_explosion Fluffy_Pillow 58760.0/63371: 93% mana bloodlust, arcane_charge(3), presence_of_mind(3), rune_of_power
0:31.220 aoe q arcane_barrage Fluffy_Pillow 55036.3/63371: 87% mana bloodlust, arcane_charge(4), presence_of_mind(3)
0:32.225 aoe p arcane_explosion Fluffy_Pillow 58844.9/63371: 93% mana bloodlust, presence_of_mind(3)
0:33.232 aoe p arcane_explosion Fluffy_Pillow 55121.2/63371: 87% mana bloodlust, arcane_charge, presence_of_mind(3)
0:34.237 aoe p arcane_explosion Fluffy_Pillow 51394.9/63371: 81% mana bloodlust, arcane_charge(2), presence_of_mind(3)
0:35.244 aoe p arcane_explosion Fluffy_Pillow 47671.2/63371: 75% mana bloodlust, arcane_charge(3), presence_of_mind(3)
0:36.250 aoe q arcane_barrage Fluffy_Pillow 43946.3/63371: 69% mana bloodlust, arcane_charge(4), presence_of_mind(3)
0:37.257 aoe p arcane_explosion Fluffy_Pillow 47757.4/63371: 75% mana bloodlust, presence_of_mind(3)
0:38.264 aoe p arcane_explosion Fluffy_Pillow 44033.7/63371: 69% mana bloodlust, arcane_charge, clearcasting, presence_of_mind(3)
0:39.271 aoe p arcane_explosion Fluffy_Pillow 45310.0/63371: 71% mana bloodlust, arcane_charge(2), presence_of_mind(3)
0:40.276 aoe p arcane_explosion Fluffy_Pillow 41583.8/63371: 66% mana bloodlust, arcane_charge(3), clearcasting, presence_of_mind(3)
0:41.283 aoe q arcane_barrage Fluffy_Pillow 42860.1/63371: 68% mana arcane_charge(4), presence_of_mind(3)
0:42.589 aoe p arcane_explosion Fluffy_Pillow 47050.2/63371: 74% mana presence_of_mind(3)
0:43.896 aoe p arcane_explosion Fluffy_Pillow 43706.7/63371: 69% mana arcane_charge, presence_of_mind(3)
0:45.202 aoe p arcane_explosion Fluffy_Pillow 40362.0/63371: 64% mana arcane_charge(2), presence_of_mind(3)
0:46.507 aoe p arcane_explosion Fluffy_Pillow 37016.0/63371: 58% mana arcane_charge(3), presence_of_mind(3)
0:47.815 aoe q arcane_barrage Fluffy_Pillow 33673.8/63371: 53% mana arcane_charge(4), presence_of_mind(3)
0:49.122 aoe o arcane_orb Fluffy_Pillow 37865.2/63371: 60% mana presence_of_mind(3)
0:50.428 aoe q arcane_barrage Fluffy_Pillow 39020.5/63371: 62% mana arcane_charge(4), presence_of_mind(3)
0:51.735 aoe p arcane_explosion Fluffy_Pillow 43211.8/63371: 68% mana presence_of_mind(3)
0:53.041 aoe p arcane_explosion Fluffy_Pillow 39867.1/63371: 63% mana arcane_charge, presence_of_mind(3)
0:54.348 aoe p arcane_explosion Fluffy_Pillow 36523.6/63371: 58% mana arcane_charge(2), presence_of_mind(3)
0:55.655 aoe p arcane_explosion Fluffy_Pillow 33180.2/63371: 52% mana arcane_charge(3), clearcasting, presence_of_mind(3)
0:56.963 aoe q arcane_barrage Fluffy_Pillow 34838.0/63371: 55% mana arcane_charge(4), presence_of_mind(3)
0:58.270 aoe p arcane_explosion Fluffy_Pillow 39029.3/63371: 62% mana presence_of_mind(3)
0:59.575 aoe p arcane_explosion Fluffy_Pillow 35683.3/63371: 56% mana arcane_charge, clearcasting, presence_of_mind(3)
1:00.880 aoe p arcane_explosion Fluffy_Pillow 37337.3/63371: 59% mana arcane_charge(2), presence_of_mind(3)
1:02.187 aoe p arcane_explosion Fluffy_Pillow 33993.9/63371: 54% mana arcane_charge(3), presence_of_mind(3)
1:03.493 aoe q arcane_barrage Fluffy_Pillow 30649.1/63371: 48% mana arcane_charge(4), presence_of_mind(3)
1:04.800 aoe k touch_of_the_magi Fluffy_Pillow 34840.5/63371: 55% mana presence_of_mind(3)
1:06.105 aoe m rune_of_power Fluffy_Pillow 33994.5/63371: 54% mana arcane_charge(4), presence_of_mind(3)
1:07.412 aoe q arcane_barrage Fluffy_Pillow 35651.0/63371: 56% mana arcane_charge(4), presence_of_mind(3), rune_of_power
1:08.719 aoe p arcane_explosion Fluffy_Pillow 39842.4/63371: 63% mana presence_of_mind(3), rune_of_power
1:10.025 aoe p arcane_explosion Fluffy_Pillow 36497.7/63371: 58% mana arcane_charge, presence_of_mind(3), rune_of_power
1:11.331 aoe p arcane_explosion Fluffy_Pillow 33152.9/63371: 52% mana arcane_charge(2), clearcasting, presence_of_mind(3), rune_of_power
1:12.636 aoe p arcane_explosion Fluffy_Pillow 34806.9/63371: 55% mana arcane_charge(3), presence_of_mind(3), rune_of_power
1:13.944 aoe q arcane_barrage Fluffy_Pillow 31464.7/63371: 50% mana arcane_charge(4), presence_of_mind(3), rune_of_power
1:15.253 aoe o arcane_orb Fluffy_Pillow 35658.7/63371: 56% mana presence_of_mind(3), rune_of_power
1:16.560 aoe q arcane_barrage Fluffy_Pillow 36815.2/63371: 58% mana arcane_charge(4), presence_of_mind(3), rune_of_power
1:17.867 aoe p arcane_explosion Fluffy_Pillow 41006.6/63371: 65% mana presence_of_mind(3), rune_of_power
1:19.175 aoe p arcane_explosion Fluffy_Pillow 37664.4/63371: 59% mana arcane_charge, presence_of_mind(3), rune_of_power
1:20.480 aoe p arcane_explosion Fluffy_Pillow 34318.4/63371: 54% mana arcane_charge(2), clearcasting, presence_of_mind(3)
1:21.787 aoe p arcane_explosion Fluffy_Pillow 35974.9/63371: 57% mana arcane_charge(3), presence_of_mind(3)
1:23.094 aoe q arcane_barrage Fluffy_Pillow 32631.4/63371: 51% mana arcane_charge(4), presence_of_mind(3)
1:24.401 aoe p arcane_explosion Fluffy_Pillow 36822.8/63371: 58% mana presence_of_mind(3)
1:25.709 aoe p arcane_explosion Fluffy_Pillow 33480.6/63371: 53% mana arcane_charge, presence_of_mind(3)
1:27.016 aoe p arcane_explosion Fluffy_Pillow 30137.1/63371: 48% mana arcane_charge(2), presence_of_mind(3)
1:28.322 aoe p arcane_explosion Fluffy_Pillow 26792.4/63371: 42% mana arcane_charge(3), presence_of_mind(3)
1:29.630 aoe q arcane_barrage Fluffy_Pillow 23450.2/63371: 37% mana arcane_charge(4), presence_of_mind(3)
1:30.937 aoe p arcane_explosion Fluffy_Pillow 27641.6/63371: 44% mana presence_of_mind(3)
1:32.241 aoe p arcane_explosion Fluffy_Pillow 24294.3/63371: 38% mana arcane_charge, clearcasting, presence_of_mind(3)
1:33.551 aoe p arcane_explosion Fluffy_Pillow 25954.6/63371: 41% mana arcane_charge(2), presence_of_mind(3)
1:34.857 aoe p arcane_explosion Fluffy_Pillow 22609.9/63371: 36% mana arcane_charge(3), presence_of_mind(3)
1:36.165 aoe q arcane_barrage Fluffy_Pillow 19267.7/63371: 30% mana arcane_charge(4), presence_of_mind(3)
1:37.472 aoe o arcane_orb Fluffy_Pillow 23459.1/63371: 37% mana presence_of_mind(3)
1:38.780 aoe q arcane_barrage Fluffy_Pillow 24616.9/63371: 39% mana arcane_charge(4), presence_of_mind(3)
1:40.088 aoe p arcane_explosion Fluffy_Pillow 28809.5/63371: 45% mana presence_of_mind(3)
1:41.396 aoe p arcane_explosion Fluffy_Pillow 25467.3/63371: 40% mana arcane_charge, presence_of_mind(3)
1:42.703 aoe p arcane_explosion Fluffy_Pillow 22123.9/63371: 35% mana arcane_charge(2), presence_of_mind(3)
1:44.008 aoe p arcane_explosion Fluffy_Pillow 18777.8/63371: 30% mana arcane_charge(3), presence_of_mind(3)
1:45.313 aoe q arcane_barrage Fluffy_Pillow 15431.8/63371: 24% mana arcane_charge(4), presence_of_mind(3)
1:46.619 aoe p arcane_explosion Fluffy_Pillow 19622.0/63371: 31% mana presence_of_mind(3)
1:47.925 aoe p arcane_explosion Fluffy_Pillow 16277.2/63371: 26% mana arcane_charge, presence_of_mind(3)
1:49.231 aoe p arcane_explosion Fluffy_Pillow 12932.5/63371: 20% mana arcane_charge(2), clearcasting, presence_of_mind(3)
1:50.536 aoe p arcane_explosion Fluffy_Pillow 14586.5/63371: 23% mana arcane_charge(3), presence_of_mind(3)
1:51.842 aoe q arcane_barrage Fluffy_Pillow 11241.7/63371: 18% mana arcane_charge(4), clearcasting, presence_of_mind(3)
1:53.149 aoe k touch_of_the_magi Fluffy_Pillow 15433.1/63371: 24% mana clearcasting, presence_of_mind(3)
1:54.456 aoe m rune_of_power Fluffy_Pillow 14589.7/63371: 23% mana arcane_charge(4), clearcasting, presence_of_mind(3)
1:55.761 aoe q arcane_barrage Fluffy_Pillow 16243.6/63371: 26% mana arcane_charge(4), clearcasting(2), presence_of_mind(3), rune_of_power
1:57.068 aoe p arcane_explosion Fluffy_Pillow 20435.0/63371: 32% mana clearcasting(2), presence_of_mind(3), rune_of_power
1:58.377 aoe p arcane_explosion Fluffy_Pillow 22094.1/63371: 35% mana arcane_charge, clearcasting, presence_of_mind(3), rune_of_power
1:59.684 aoe p arcane_explosion Fluffy_Pillow 23750.6/63371: 37% mana arcane_charge(2), presence_of_mind(3), rune_of_power
2:00.991 aoe p arcane_explosion Fluffy_Pillow 20407.2/63371: 32% mana arcane_charge(3), presence_of_mind(3), rune_of_power
2:02.299 aoe q arcane_barrage Fluffy_Pillow 17065.0/63371: 27% mana arcane_charge(4), presence_of_mind(3), rune_of_power
2:03.607 aoe o arcane_orb Fluffy_Pillow 21257.6/63371: 34% mana presence_of_mind(3), rune_of_power
2:04.913 aoe q arcane_barrage Fluffy_Pillow 22412.9/63371: 35% mana arcane_charge(4), presence_of_mind(3), rune_of_power
2:06.219 aoe p arcane_explosion Fluffy_Pillow 26603.0/63371: 42% mana presence_of_mind(3), rune_of_power
2:07.526 aoe p arcane_explosion Fluffy_Pillow 23259.5/63371: 37% mana arcane_charge, clearcasting, presence_of_mind(3), rune_of_power
2:08.832 aoe p arcane_explosion Fluffy_Pillow 24914.8/63371: 39% mana arcane_charge(2), presence_of_mind(3)
2:10.140 aoe p arcane_explosion Fluffy_Pillow 21572.6/63371: 34% mana arcane_charge(3), presence_of_mind(3)
2:11.446 aoe l arcane_power Fluffy_Pillow 18227.8/63371: 29% mana arcane_charge(4), clearcasting, presence_of_mind(3)
2:11.446 aoe q arcane_barrage Fluffy_Pillow 18227.8/63371: 29% mana arcane_charge(4), arcane_power, clearcasting, presence_of_mind(3), rune_of_power
2:12.751 aoe p arcane_explosion Fluffy_Pillow 22416.7/63371: 35% mana arcane_power, clearcasting, presence_of_mind(3), rune_of_power
2:14.058 aoe p arcane_explosion Fluffy_Pillow 24073.2/63371: 38% mana arcane_charge, arcane_power, presence_of_mind(3), rune_of_power
2:15.366 aoe p arcane_explosion Fluffy_Pillow 23231.0/63371: 37% mana arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power
2:16.672 aoe p arcane_explosion Fluffy_Pillow 22386.3/63371: 35% mana arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power
2:17.980 aoe q arcane_barrage Fluffy_Pillow 21544.1/63371: 34% mana arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power
2:19.286 aoe p arcane_explosion Fluffy_Pillow 25734.2/63371: 41% mana arcane_power, presence_of_mind(3), rune_of_power
2:20.594 aoe p arcane_explosion Fluffy_Pillow 24892.0/63371: 39% mana arcane_charge, arcane_power, presence_of_mind(3), rune_of_power
2:21.901 aoe p arcane_explosion Fluffy_Pillow 24048.5/63371: 38% mana arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power
2:23.207 shared_cds s use_mana_gem Necrolord_Marileth 23203.8/63371: 37% mana arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power
2:23.207 aoe p arcane_explosion Fluffy_Pillow 29540.9/63371: 47% mana arcane_charge(3), arcane_power, presence_of_mind(3), rune_of_power
2:24.512 aoe q arcane_barrage Fluffy_Pillow 28694.9/63371: 45% mana arcane_charge(4), arcane_power, presence_of_mind(3)
2:25.818 aoe o arcane_orb Fluffy_Pillow 32885.0/63371: 52% mana arcane_power, presence_of_mind(3)
2:27.126 aoe q arcane_barrage Fluffy_Pillow 34292.8/63371: 54% mana arcane_charge(4), presence_of_mind(3)
2:28.431 aoe p arcane_explosion Fluffy_Pillow 38481.7/63371: 61% mana presence_of_mind(3)
2:29.739 aoe p arcane_explosion Fluffy_Pillow 35139.5/63371: 55% mana arcane_charge, clearcasting, presence_of_mind(3)
2:31.046 aoe p arcane_explosion Fluffy_Pillow 36796.0/63371: 58% mana arcane_charge(2), presence_of_mind(3)
2:32.352 aoe p arcane_explosion Fluffy_Pillow 33451.3/63371: 53% mana arcane_charge(3), presence_of_mind(3)
2:33.658 aoe q arcane_barrage Fluffy_Pillow 30106.5/63371: 48% mana arcane_charge(4), clearcasting, presence_of_mind(3)
2:34.964 aoe p arcane_explosion Fluffy_Pillow 34296.6/63371: 54% mana clearcasting, presence_of_mind(3)
2:36.269 aoe p arcane_explosion Fluffy_Pillow 35950.6/63371: 57% mana arcane_charge, presence_of_mind(3)
2:37.575 aoe p arcane_explosion Fluffy_Pillow 32605.9/63371: 51% mana arcane_charge(2), presence_of_mind(3)
2:38.880 aoe p arcane_explosion Fluffy_Pillow 29259.9/63371: 46% mana arcane_charge(3), presence_of_mind(3)
2:40.188 aoe q arcane_barrage Fluffy_Pillow 25917.7/63371: 41% mana arcane_charge(4), presence_of_mind(3)
2:41.495 aoe k touch_of_the_magi Fluffy_Pillow 30109.1/63371: 48% mana presence_of_mind(3)
2:42.802 aoe m rune_of_power Fluffy_Pillow 29265.6/63371: 46% mana arcane_charge(4), presence_of_mind(3)
2:44.107 aoe q arcane_barrage Fluffy_Pillow 30919.6/63371: 49% mana arcane_charge(4), presence_of_mind(3), rune_of_power
2:45.414 aoe p arcane_explosion Fluffy_Pillow 35111.0/63371: 55% mana presence_of_mind(3), rune_of_power
2:46.721 aoe p arcane_explosion Fluffy_Pillow 31767.5/63371: 50% mana arcane_charge, presence_of_mind(3), rune_of_power
2:48.028 aoe p arcane_explosion Fluffy_Pillow 28424.1/63371: 45% mana arcane_charge(2), presence_of_mind(3), rune_of_power
2:49.333 aoe p arcane_explosion Fluffy_Pillow 25078.0/63371: 40% mana arcane_charge(3), presence_of_mind(3), rune_of_power
2:50.640 aoe q arcane_barrage Fluffy_Pillow 21734.6/63371: 34% mana arcane_charge(4), presence_of_mind(3), rune_of_power
2:51.948 aoe o arcane_orb Fluffy_Pillow 25927.2/63371: 41% mana presence_of_mind(3), rune_of_power
2:53.254 aoe q arcane_barrage Fluffy_Pillow 27082.5/63371: 43% mana arcane_charge(4), presence_of_mind(3), rune_of_power
2:54.559 aoe p arcane_explosion Fluffy_Pillow 31271.3/63371: 49% mana presence_of_mind(3), rune_of_power
2:55.865 aoe p arcane_explosion Fluffy_Pillow 27926.6/63371: 44% mana arcane_charge, presence_of_mind(3), rune_of_power
2:57.171 aoe p arcane_explosion Fluffy_Pillow 24581.9/63371: 39% mana arcane_charge(2), presence_of_mind(3)
2:58.478 aoe p arcane_explosion Fluffy_Pillow 21238.4/63371: 34% mana arcane_charge(3), presence_of_mind(3)
2:59.785 aoe q arcane_barrage Fluffy_Pillow 17894.9/63371: 28% mana arcane_charge(4), presence_of_mind(3)
3:01.092 aoe p arcane_explosion Fluffy_Pillow 22086.3/63371: 35% mana presence_of_mind(3)
3:02.400 aoe p arcane_explosion Fluffy_Pillow 18744.1/63371: 30% mana arcane_charge, clearcasting, presence_of_mind(3)
3:03.707 aoe p arcane_explosion Fluffy_Pillow 20400.6/63371: 32% mana arcane_charge(2), presence_of_mind(3)
3:05.011 aoe p arcane_explosion Fluffy_Pillow 17053.4/63371: 27% mana arcane_charge(3), clearcasting, presence_of_mind(3)
3:06.317 aoe q arcane_barrage Fluffy_Pillow 18708.6/63371: 30% mana arcane_charge(4), presence_of_mind(3)
3:07.623 aoe p arcane_explosion Fluffy_Pillow 22898.7/63371: 36% mana presence_of_mind(3)
3:08.931 aoe p arcane_explosion Fluffy_Pillow 19556.5/63371: 31% mana arcane_charge, presence_of_mind(3)
3:10.239 aoe p arcane_explosion Fluffy_Pillow 16214.3/63371: 26% mana arcane_charge(2), presence_of_mind(3)
3:11.546 aoe p arcane_explosion Fluffy_Pillow 12870.9/63371: 20% mana arcane_charge(3), presence_of_mind(3)
3:12.854 aoe q arcane_barrage Fluffy_Pillow 9528.7/63371: 15% mana arcane_charge(4), presence_of_mind(3)
3:14.159 aoe o arcane_orb Fluffy_Pillow 13717.5/63371: 22% mana presence_of_mind(3)
3:15.466 aoe q arcane_barrage Fluffy_Pillow 14874.0/63371: 23% mana arcane_charge(4), presence_of_mind(3)
3:16.771 aoe p arcane_explosion Fluffy_Pillow 19062.9/63371: 30% mana presence_of_mind(3)
3:18.077 aoe p arcane_explosion Fluffy_Pillow 15718.2/63371: 25% mana arcane_charge, presence_of_mind(3)
3:19.384 aoe p arcane_explosion Fluffy_Pillow 12374.7/63371: 20% mana arcane_charge(2), presence_of_mind(3)
3:20.691 aoe p arcane_explosion Fluffy_Pillow 9031.2/63371: 14% mana arcane_charge(3), presence_of_mind(3)
3:21.997 aoe q arcane_barrage Fluffy_Pillow 5686.5/63371: 9% mana arcane_charge(4), presence_of_mind(3)
3:23.303 aoe p arcane_explosion Fluffy_Pillow 9876.6/63371: 16% mana presence_of_mind(3)
3:24.610 aoe p arcane_explosion Fluffy_Pillow 6533.1/63371: 10% mana arcane_charge, presence_of_mind(3)
3:25.917 aoe p arcane_explosion Fluffy_Pillow 3189.7/63371: 5% mana arcane_charge(2), clearcasting, presence_of_mind(3)
3:27.224 aoe r evocation Necrolord_Marileth 4846.2/63371: 8% mana arcane_charge(3), presence_of_mind(3)
3:31.569 aoe p arcane_explosion Fluffy_Pillow 58692.1/63371: 93% mana arcane_charge(3), presence_of_mind(3)
3:32.873 aoe q arcane_barrage Fluffy_Pillow 55344.8/63371: 87% mana arcane_charge(4), presence_of_mind(3)
3:34.179 aoe k touch_of_the_magi Fluffy_Pillow 59535.0/63371: 94% mana presence_of_mind(3)
3:35.485 aoe m rune_of_power Fluffy_Pillow 58690.2/63371: 93% mana arcane_charge(4), presence_of_mind(3)
3:36.791 aoe q arcane_barrage Fluffy_Pillow 60345.5/63371: 95% mana arcane_charge(4), presence_of_mind(3), rune_of_power
3:38.097 aoe o arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana presence_of_mind(3), rune_of_power
3:39.403 aoe q arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge(4), presence_of_mind(3), rune_of_power
3:40.710 aoe p arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana presence_of_mind(3), rune_of_power
3:42.017 aoe p arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge, presence_of_mind(3), rune_of_power
3:43.323 aoe p arcane_explosion Fluffy_Pillow 56683.2/63371: 89% mana arcane_charge(2), presence_of_mind(3), rune_of_power
3:44.629 aoe p arcane_explosion Fluffy_Pillow 53338.5/63371: 84% mana arcane_charge(3), clearcasting, presence_of_mind(3), rune_of_power
3:45.937 aoe q arcane_barrage Fluffy_Pillow 54996.3/63371: 87% mana arcane_charge(4), presence_of_mind(3), rune_of_power
3:47.243 aoe p arcane_explosion Fluffy_Pillow 59186.4/63371: 93% mana presence_of_mind(3), rune_of_power
3:48.549 aoe p arcane_explosion Fluffy_Pillow 55841.7/63371: 88% mana arcane_charge, presence_of_mind(3), rune_of_power
3:49.856 aoe p arcane_explosion Fluffy_Pillow 52498.2/63371: 83% mana arcane_charge(2), presence_of_mind(3)
3:51.162 aoe p arcane_explosion Fluffy_Pillow 49153.4/63371: 78% mana arcane_charge(3), presence_of_mind(3)
3:52.468 aoe q arcane_barrage Fluffy_Pillow 45808.7/63371: 72% mana arcane_charge(4), presence_of_mind(3)
3:53.775 aoe p arcane_explosion Fluffy_Pillow 50000.1/63371: 79% mana presence_of_mind(3)
3:55.083 aoe p arcane_explosion Fluffy_Pillow 46657.9/63371: 74% mana arcane_charge, presence_of_mind(3)
3:56.391 aoe p arcane_explosion Fluffy_Pillow 43315.7/63371: 68% mana arcane_charge(2), presence_of_mind(3)
3:57.697 aoe p arcane_explosion Fluffy_Pillow 39971.0/63371: 63% mana arcane_charge(3), presence_of_mind(3)
3:59.005 aoe q arcane_barrage Fluffy_Pillow 36628.7/63371: 58% mana arcane_charge(4), presence_of_mind(3)
4:00.312 aoe o arcane_orb Fluffy_Pillow 40820.1/63371: 64% mana presence_of_mind(3)
4:01.617 aoe q arcane_barrage Fluffy_Pillow 41974.1/63371: 66% mana arcane_charge(4), presence_of_mind(3)
4:02.922 aoe p arcane_explosion Fluffy_Pillow 46163.0/63371: 73% mana presence_of_mind(3)
4:04.227 aoe p arcane_explosion Fluffy_Pillow 42817.0/63371: 68% mana arcane_charge, presence_of_mind(3)
4:05.533 aoe p arcane_explosion Fluffy_Pillow 39472.2/63371: 62% mana arcane_charge(2), presence_of_mind(3)
4:06.839 aoe p arcane_explosion Fluffy_Pillow 36127.5/63371: 57% mana arcane_charge(3), presence_of_mind(3)
4:08.146 aoe q arcane_barrage Fluffy_Pillow 32784.0/63371: 52% mana arcane_charge(4), presence_of_mind(3)
4:09.454 aoe p arcane_explosion Fluffy_Pillow 36976.7/63371: 58% mana presence_of_mind(3)
4:10.759 aoe p arcane_explosion Fluffy_Pillow 33630.7/63371: 53% mana arcane_charge, presence_of_mind(3)
4:12.066 aoe p arcane_explosion Fluffy_Pillow 30287.2/63371: 48% mana arcane_charge(2), presence_of_mind(3)
4:13.371 aoe p arcane_explosion Fluffy_Pillow 26941.2/63371: 43% mana arcane_charge(3), presence_of_mind(3)
4:14.678 aoe q arcane_barrage Fluffy_Pillow 23597.7/63371: 37% mana arcane_charge(4), presence_of_mind(3)
4:15.984 aoe p arcane_explosion Fluffy_Pillow 27787.8/63371: 44% mana presence_of_mind(3)
4:17.291 aoe p arcane_explosion Fluffy_Pillow 24444.4/63371: 39% mana arcane_charge, presence_of_mind(3)
4:18.600 aoe p arcane_explosion Fluffy_Pillow 21103.4/63371: 33% mana arcane_charge(2), presence_of_mind(3)
4:19.907 aoe p arcane_explosion Fluffy_Pillow 17760.0/63371: 28% mana arcane_charge(3), clearcasting, presence_of_mind(3)
4:21.213 aoe q arcane_barrage Fluffy_Pillow 19415.2/63371: 31% mana arcane_charge(4), presence_of_mind(3)
4:22.520 aoe j deathborne Fluffy_Pillow 23606.6/63371: 37% mana presence_of_mind(3)
4:23.828 shared_cds s use_mana_gem Necrolord_Marileth 22764.4/63371: 36% mana presence_of_mind(3), deathborne
4:23.828 aoe k touch_of_the_magi Fluffy_Pillow 29101.6/63371: 46% mana presence_of_mind(3), deathborne
4:25.135 aoe l arcane_power Fluffy_Pillow 28258.1/63371: 45% mana arcane_charge(4), presence_of_mind(3), deathborne
4:25.135 shared_cds u berserking Fluffy_Pillow 28258.1/63371: 45% mana arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne
4:25.135 aoe q arcane_barrage Fluffy_Pillow 28258.1/63371: 45% mana berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne
4:26.325 aoe o arcane_orb Fluffy_Pillow 32301.2/63371: 51% mana berserking, arcane_power, presence_of_mind(3), rune_of_power, deathborne
4:27.514 aoe q arcane_barrage Fluffy_Pillow 33558.2/63371: 53% mana berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne
4:28.701 aoe p arcane_explosion Fluffy_Pillow 37597.5/63371: 59% mana berserking, arcane_power, presence_of_mind(3), rune_of_power, deathborne
4:29.888 aoe p arcane_explosion Fluffy_Pillow 36601.9/63371: 58% mana berserking, arcane_charge, arcane_power, presence_of_mind(3), rune_of_power, deathborne
4:31.075 aoe p arcane_explosion Fluffy_Pillow 35606.3/63371: 56% mana berserking, arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power, deathborne
4:32.263 aoe p arcane_explosion Fluffy_Pillow 34612.0/63371: 55% mana berserking, arcane_charge(3), arcane_power, clearcasting, presence_of_mind(3), rune_of_power, deathborne
4:33.453 aoe q arcane_barrage Fluffy_Pillow 36120.3/63371: 57% mana berserking, arcane_charge(4), arcane_power, presence_of_mind(3), rune_of_power, deathborne
4:34.642 aoe p arcane_explosion Fluffy_Pillow 40162.1/63371: 63% mana berserking, arcane_power, presence_of_mind(3), rune_of_power, deathborne
4:35.830 aoe p arcane_explosion Fluffy_Pillow 39167.8/63371: 62% mana berserking, arcane_charge, arcane_power, presence_of_mind(3), rune_of_power, deathborne
4:37.019 aoe p arcane_explosion Fluffy_Pillow 38174.8/63371: 60% mana berserking, arcane_charge(2), arcane_power, presence_of_mind(3), rune_of_power, deathborne
4:38.208 aoe p arcane_explosion Fluffy_Pillow 37181.8/63371: 59% mana arcane_charge(3), arcane_power, presence_of_mind(3), deathborne
4:39.513 aoe m rune_of_power Fluffy_Pillow 36335.7/63371: 57% mana arcane_charge(4), arcane_power, presence_of_mind(3), deathborne
4:40.819 aoe q arcane_barrage Fluffy_Pillow 37991.0/63371: 60% mana arcane_charge(4), presence_of_mind(3), rune_of_power, deathborne
4:42.124 aoe p arcane_explosion Fluffy_Pillow 42179.9/63371: 67% mana presence_of_mind(3), rune_of_power, deathborne

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Necrolord_Marileth"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=necrolord
soulbind=arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

NightFae_Dream : 16886 dps, 4605 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16885.6 16885.6 20.4 / 0.121% 1273.4 / 7.5% 8.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
1888.3 1784.8 Mana 0.00% 47.9 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Dream 16886
Arcane Barrage 5631 33.3% 54.4 5.54sec 31074 25098 Direct 271.8 5210 10486 6226 19.2%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.43 271.81 0.00 0.00 1.2381 0.0000 1691411.35 1691411.35 0.00% 25097.73 25097.73
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.76% 219.51 166 278 5209.99 2082 25140 5208.65 4801 5632 1143196 1143196 0.00%
crit 19.24% 52.29 27 81 10485.82 4164 50280 10490.36 7891 14243 548215 548215 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:54.44
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 474 2.8% 41.2 6.95sec 3449 0 Direct 206.1 579 1158 690 19.2%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.21 206.07 0.00 0.00 0.0000 0.0000 142166.97 142166.97 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.78% 166.47 121 211 578.56 443 664 578.45 558 599 96295 96295 0.00%
crit 19.22% 39.60 16 63 1158.36 886 1329 1158.19 1061 1260 45872 45872 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 7448 44.1% 142.7 2.08sec 15683 12603 Direct 713.3 2629 5264 3136 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 142.65 713.25 0.00 0.00 1.2444 0.0000 2237132.80 2237132.80 0.00% 12602.71 12602.71
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 575.91 448 713 2628.92 1958 4112 2629.18 2540 2704 1514094 1514094 0.00%
crit 19.26% 137.34 89 187 5264.06 3916 8223 5264.74 4919 5835 723039 723039 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:142.64
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1446) 0.0% (8.6%) 13.4 22.95sec 32308 26389

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.44 0.00 0.00 0.00 1.2243 0.0000 0.00 0.00 0.00% 26389.49 26389.49

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.44
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1446 8.6% 67.1 22.95sec 6472 0 Direct 67.1 5422 10821 6469 19.4%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 67.11 67.11 0.00 0.00 0.0000 0.0000 434318.29 434318.29 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.58% 54.08 37 71 5421.94 3869 8126 5420.84 5030 5777 293229 293229 0.00%
crit 19.42% 13.03 3 25 10820.89 7739 16251 10806.41 7739 14897 141089 141089 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (86) 0.0% (0.5%) 18.8 9.07sec 1391 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.84 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 86 0.5% 18.8 9.07sec 1391 0 Direct 18.8 1164 2327 1390 19.6%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.84 18.84 0.00 0.00 0.0000 0.0000 26203.46 26203.46 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.44% 15.15 4 30 1163.53 1164 1164 1163.53 1164 1164 17629 17629 0.00%
crit 19.56% 3.68 0 11 2327.06 2327 2327 2263.06 0 2327 8574 8574 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1757 18.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1752.67 1752.67 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.63% 0.82 0 1 1480.68 1481 1481 1208.69 0 1481 1209 1209 0.00%
crit 18.37% 0.18 0 1 2961.35 2961 2961 543.98 0 2961 544 544 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.1%) 1.0 0.00sec 5790 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 145  / 20 0.1% 90.0 1.29sec 64 49 Direct 90.0 54 108 64 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5789.68 5789.68 0.00% 49.16 49.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 72.62 57 83 53.94 43 60 53.95 53 56 3918 3918 0.00%
crit 19.31% 17.38 7 33 107.75 86 120 107.74 96 120 1872 1872 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Shifting Power 657 3.9% 6.1 48.42sec 32500 9111 Periodic 120.7 1372 2745 1637 19.3% 1.3%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.08 0.00 24.14 120.72 3.5671 0.8349 197583.80 197583.80 0.00% 9111.12 9111.12
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.73% 97.46 71 126 1372.31 1372 1372 1372.31 1372 1372 133751 133751 0.00%
crit 19.27% 23.26 7 40 2744.61 2745 2745 2744.61 2745 2745 63832 63832 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:6.08
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (1119) 0.0% (6.6%) 6.6 48.80sec 50523 38672

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.64 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 38672.01 38672.01

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.68
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 1119 6.6% 6.6 48.65sec 50523 0 Direct 33.0 10176 0 10176 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.64 33.01 0.00 0.00 0.0000 0.0000 335595.70 335595.70 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 33.01 25 40 10175.59 2616 48546 10192.83 8411 13331 335596 335596 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10631.11
  • base_dd_max:10631.11
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
NightFae_Dream
Arcane Power 3.6 97.16sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.57 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.58
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.71sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.3 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.27 0.00 1.55 0.00 4.1969 0.7191 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.26
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.40sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.49
  • if_expr:buff.arcane_power.up
Rune of Power 6.5 47.08sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.48 0.00 0.00 0.00 1.2602 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.51
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 120.74sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.80 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.81
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 55.2 174.7 5.5sec 1.3sec 4.1sec 75.65% 0.00% 29.0 (30.1) 0.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 14.7s
  • trigger_min/max:0.0s / 9.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.4s

Stack Uptimes

  • arcane_charge_1:18.19%
  • arcane_charge_2:15.60%
  • arcane_charge_3:14.61%
  • arcane_charge_4:27.25%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.6 0.0 97.2sec 97.2sec 14.7sec 17.48% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 102.0s
  • trigger_min/max:96.0s / 102.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:17.48%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 194.7sec 194.7sec 12.0sec 8.09% 23.63% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:192.7s / 199.3s
  • trigger_min/max:192.7s / 199.3s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.09%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.5 0.2 12.9sec 12.8sec 2.3sec 16.86% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.52%
  • clearcasting_2:0.35%
  • clearcasting_3:0.03%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.3 0.0 0.0sec 0.0sec 4.2sec 0.37% 0.00% 1.0 (1.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.8s / 4.3s

Stack Uptimes

  • evocation_1:0.38%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.5 0.0 300.4sec 300.4sec 23.4sec 11.37% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 301.0s
  • trigger_min/max:300.0s / 301.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.37%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 10.1 0.0 31.1sec 31.1sec 11.8sec 39.32% 0.00% 0.0 (0.0) 9.7

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.4s / 48.9s
  • trigger_min/max:14.4s / 48.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:39.32%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.67% 0.76% 6.18% 0.9s 0.0s 3.9s
Conserve Phase 100.00% 100.00% 100.00% 300.7s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000204.660144.091263.937
Evocation234.746127.191349.912286.646175.415359.937
Rune of Power13.4900.01131.42190.78772.352108.893
Touch of the Magi12.2180.00021.70984.18968.052106.950
Arcane Power1.2040.0036.0214.3131.9929.055
Arcane Barrage3.0340.00312.139166.482132.759199.912
Arcane Orb4.2640.00011.71457.94437.85976.143
Shifting Power7.8370.00030.23247.85842.73757.103

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Dream
mana_regen Mana 693.86 373046.43 69.52% 537.64 7451.41 1.96%
Evocation Mana 12.40 12458.89 2.32% 1005.11 0.00 0.00%
Mana Gem Mana 2.80 17767.29 3.31% 6337.14 0.00 0.00%
Arcane Barrage Mana 54.44 133298.64 24.84% 2448.58 4696.63 3.40%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1784.78 1888.35 12134.7 32233.1 222.9 63371.4
Usage Type Count Total Avg RPE APR
NightFae_Dream
arcane_explosion Mana 142.6 528921.7 3708.0 3707.8 4.2
arcane_orb Mana 13.4 5847.2 435.0 435.0 74.3
shifting_power Mana 6.1 15195.8 2500.0 2499.5 13.0
touch_of_the_magi Mana 6.6 16619.9 2500.0 2502.1 20.2

Statistics & Data Analysis

Fight Length
NightFae_Dream Fight Length
Count 1018
Mean 300.66
Minimum 240.09
Maximum 359.94
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
NightFae_Dream Damage Per Second
Count 1018
Mean 16885.59
Minimum 15911.09
Maximum 17858.26
Spread ( max - min ) 1947.17
Range [ ( max - min ) / 2 * 100% ] 5.77%
Standard Deviation 332.5611
5th Percentile 16362.65
95th Percentile 17445.88
( 95th Percentile - 5th Percentile ) 1083.24
Mean Distribution
Standard Deviation 10.4231
95.00% Confidence Interval ( 16865.16 - 16906.02 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1491
0.1 Scale Factor Error with Delta=300 945
0.05 Scale Factor Error with Delta=300 3777
0.01 Scale Factor Error with Delta=300 94412
Priority Target DPS
NightFae_Dream Priority Target Damage Per Second
Count 1018
Mean 4605.45
Minimum 4183.55
Maximum 5070.71
Spread ( max - min ) 887.16
Range [ ( max - min ) / 2 * 100% ] 9.63%
Standard Deviation 163.9707
5th Percentile 4354.47
95th Percentile 4890.78
( 95th Percentile - 5th Percentile ) 536.31
Mean Distribution
Standard Deviation 5.1392
95.00% Confidence Interval ( 4595.38 - 4615.52 )
Normalized 95.00% Confidence Interval ( 99.78% - 100.22% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4870
0.1 Scale Factor Error with Delta=300 230
0.05 Scale Factor Error with Delta=300 919
0.01 Scale Factor Error with Delta=300 22952
DPS(e)
NightFae_Dream Damage Per Second (Effective)
Count 1018
Mean 16885.59
Minimum 15911.09
Maximum 17858.26
Spread ( max - min ) 1947.17
Range [ ( max - min ) / 2 * 100% ] 5.77%
Damage
NightFae_Dream Damage
Count 1018
Mean 5066165.04
Minimum 4027736.46
Maximum 6247104.88
Spread ( max - min ) 2219368.42
Range [ ( max - min ) / 2 * 100% ] 21.90%
DTPS
NightFae_Dream Damage Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Dream Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Dream Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Dream Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Dream Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Dream Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_DreamTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Dream Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.68 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.58 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.51 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.44 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 6.08 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 142.64 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 54.44 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.26 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.81 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.49 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjkstpmpoooopoooopoooolpooroopmpoooonpmpoooopoooopoojlpmpoooopoooopoooonpmpoooopoooopojkpoooopmpoooolpoooopoooonpmpoooorpoooopjlpoooopmpoooopoooonpmpoooopoooopjktpoooopmpoooolpoooopoooonpmpoooopoooopjlpoooopmpooroopoooonpmpoooo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask NightFae_Dream 63371.4/63371: 100% mana
Pre precombat R food NightFae_Dream 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana
0:01.307 aoe k arcane_power Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4)
0:01.307 shared_cds s potion Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:01.307 shared_cds t berserking Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:01.307 aoe p arcane_barrage Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.222 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.137 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.052 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.965 aoe o arcane_explosion Fluffy_Pillow 62028.6/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.879 aoe o arcane_explosion Fluffy_Pillow 60687.0/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.793 aoe o arcane_explosion Fluffy_Pillow 59345.5/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.708 aoe p arcane_barrage Fluffy_Pillow 58005.1/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.622 aoe o arcane_explosion Fluffy_Pillow 61698.4/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.534 aoe o arcane_explosion Fluffy_Pillow 60354.3/63371: 95% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.450 aoe o arcane_explosion Fluffy_Pillow 59015.3/63371: 93% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.364 aoe o arcane_explosion Fluffy_Pillow 57673.7/63371: 91% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.279 aoe p arcane_barrage Fluffy_Pillow 56333.4/63371: 89% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.195 aoe o arcane_explosion Fluffy_Pillow 60029.2/63371: 95% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.111 aoe o arcane_explosion Fluffy_Pillow 58690.2/63371: 93% mana bloodlust, arcane_charge, arcane_power, potion_of_deathly_fixation
0:15.117 aoe o arcane_explosion Fluffy_Pillow 57465.2/63371: 91% mana bloodlust, arcane_charge(2), arcane_power, potion_of_deathly_fixation
0:16.121 aoe o arcane_explosion Fluffy_Pillow 56237.7/63371: 89% mana bloodlust, arcane_charge(3), arcane_power, potion_of_deathly_fixation
0:17.128 aoe l rune_of_power Fluffy_Pillow 55014.0/63371: 87% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:18.134 aoe p arcane_barrage Fluffy_Pillow 56289.1/63371: 89% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:19.142 aoe o arcane_explosion Fluffy_Pillow 60101.5/63371: 95% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:20.147 aoe o arcane_explosion Fluffy_Pillow 56375.3/63371: 89% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:21.152 shared_cds r use_mana_gem NightFae_Dream 52649.0/63371: 83% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:21.152 aoe o arcane_explosion Fluffy_Pillow 58986.2/63371: 93% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:22.160 aoe o arcane_explosion Fluffy_Pillow 55263.7/63371: 87% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.168 aoe p arcane_barrage Fluffy_Pillow 51541.3/63371: 81% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:24.175 aoe m arcane_orb Fluffy_Pillow 55352.5/63371: 87% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:25.181 aoe p arcane_barrage Fluffy_Pillow 56127.5/63371: 89% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:26.188 aoe o arcane_explosion Fluffy_Pillow 59938.7/63371: 95% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:27.194 aoe o arcane_explosion Fluffy_Pillow 61213.7/63371: 97% mana bloodlust, arcane_charge, rune_of_power
0:28.200 aoe o arcane_explosion Fluffy_Pillow 57488.7/63371: 91% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power
0:29.207 aoe o arcane_explosion Fluffy_Pillow 58765.0/63371: 93% mana bloodlust, arcane_charge(3), rune_of_power
0:30.212 aoe n shifting_power Fluffy_Pillow 55038.8/63371: 87% mana bloodlust, arcane_charge(4)
0:33.218 aoe p arcane_barrage Fluffy_Pillow 56348.7/63371: 89% mana bloodlust, arcane_charge(4)
0:34.223 aoe m arcane_orb Fluffy_Pillow 60157.3/63371: 95% mana bloodlust
0:35.229 aoe p arcane_barrage Fluffy_Pillow 60932.3/63371: 96% mana bloodlust, arcane_charge(4)
0:36.235 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust
0:37.244 aoe o arcane_explosion Fluffy_Pillow 59650.3/63371: 94% mana bloodlust, arcane_charge, clearcasting
0:38.252 aoe o arcane_explosion Fluffy_Pillow 60927.8/63371: 96% mana bloodlust, arcane_charge(2)
0:39.260 aoe o arcane_explosion Fluffy_Pillow 57205.4/63371: 90% mana bloodlust, arcane_charge(3)
0:40.267 aoe p arcane_barrage Fluffy_Pillow 53481.7/63371: 84% mana bloodlust, arcane_charge(4)
0:41.274 aoe o arcane_explosion Fluffy_Pillow 57292.9/63371: 90% mana
0:42.580 aoe o arcane_explosion Fluffy_Pillow 53948.1/63371: 85% mana arcane_charge
0:43.887 aoe o arcane_explosion Fluffy_Pillow 50604.6/63371: 80% mana arcane_charge(2)
0:45.193 aoe o arcane_explosion Fluffy_Pillow 47259.9/63371: 75% mana arcane_charge(3)
0:46.499 aoe p arcane_barrage Fluffy_Pillow 43915.2/63371: 69% mana arcane_charge(4)
0:47.805 aoe o arcane_explosion Fluffy_Pillow 48105.3/63371: 76% mana
0:49.111 aoe o arcane_explosion Fluffy_Pillow 44760.6/63371: 71% mana arcane_charge, clearcasting
0:50.417 aoe j touch_of_the_magi Fluffy_Pillow 46415.8/63371: 73% mana arcane_charge(2)
0:51.723 aoe l rune_of_power Fluffy_Pillow 45571.1/63371: 72% mana arcane_charge(4)
0:53.028 aoe p arcane_barrage Fluffy_Pillow 47225.1/63371: 75% mana arcane_charge(4), rune_of_power
0:54.337 aoe m arcane_orb Fluffy_Pillow 51419.0/63371: 81% mana rune_of_power
0:55.644 aoe p arcane_barrage Fluffy_Pillow 52575.5/63371: 83% mana arcane_charge(4), rune_of_power
0:56.950 aoe o arcane_explosion Fluffy_Pillow 56765.6/63371: 90% mana rune_of_power
0:58.255 aoe o arcane_explosion Fluffy_Pillow 53419.6/63371: 84% mana arcane_charge, rune_of_power
0:59.561 aoe o arcane_explosion Fluffy_Pillow 50074.9/63371: 79% mana arcane_charge(2), rune_of_power
1:00.866 aoe o arcane_explosion Fluffy_Pillow 46728.9/63371: 74% mana arcane_charge(3), rune_of_power
1:02.172 aoe p arcane_barrage Fluffy_Pillow 43384.2/63371: 68% mana arcane_charge(4), rune_of_power
1:03.479 aoe o arcane_explosion Fluffy_Pillow 47575.5/63371: 75% mana rune_of_power
1:04.786 aoe o arcane_explosion Fluffy_Pillow 44232.1/63371: 70% mana arcane_charge, rune_of_power
1:06.092 aoe o arcane_explosion Fluffy_Pillow 40887.3/63371: 65% mana arcane_charge(2)
1:07.399 aoe o arcane_explosion Fluffy_Pillow 37543.9/63371: 59% mana arcane_charge(3)
1:08.707 aoe p arcane_barrage Fluffy_Pillow 34201.7/63371: 54% mana arcane_charge(4), clearcasting
1:10.013 aoe o arcane_explosion Fluffy_Pillow 38391.8/63371: 61% mana clearcasting
1:11.319 aoe o arcane_explosion Fluffy_Pillow 40047.0/63371: 63% mana arcane_charge
1:12.627 aoe o arcane_explosion Fluffy_Pillow 36704.8/63371: 58% mana arcane_charge(2)
1:13.933 aoe o arcane_explosion Fluffy_Pillow 33360.1/63371: 53% mana arcane_charge(3)
1:15.238 aoe n shifting_power Fluffy_Pillow 30014.1/63371: 47% mana arcane_charge(4)
1:18.964 aoe p arcane_barrage Fluffy_Pillow 32236.5/63371: 51% mana arcane_charge(4)
1:20.270 aoe m arcane_orb Fluffy_Pillow 36426.6/63371: 57% mana
1:21.578 aoe p arcane_barrage Fluffy_Pillow 37584.4/63371: 59% mana arcane_charge(4)
1:22.885 aoe o arcane_explosion Fluffy_Pillow 41775.8/63371: 66% mana
1:24.191 aoe o arcane_explosion Fluffy_Pillow 38431.1/63371: 61% mana arcane_charge, clearcasting
1:25.496 aoe o arcane_explosion Fluffy_Pillow 40085.1/63371: 63% mana arcane_charge(2)
1:26.801 aoe o arcane_explosion Fluffy_Pillow 36739.1/63371: 58% mana arcane_charge(3), clearcasting
1:28.107 aoe p arcane_barrage Fluffy_Pillow 38394.3/63371: 61% mana arcane_charge(4)
1:29.414 aoe o arcane_explosion Fluffy_Pillow 42585.7/63371: 67% mana
1:30.719 aoe o arcane_explosion Fluffy_Pillow 39239.7/63371: 62% mana arcane_charge, clearcasting
1:32.025 aoe o arcane_explosion Fluffy_Pillow 40895.0/63371: 65% mana arcane_charge(2)
1:33.333 aoe o arcane_explosion Fluffy_Pillow 37552.8/63371: 59% mana arcane_charge(3)
1:34.641 aoe p arcane_barrage Fluffy_Pillow 34210.6/63371: 54% mana arcane_charge(4)
1:35.947 aoe o arcane_explosion Fluffy_Pillow 38400.7/63371: 61% mana
1:37.255 aoe j touch_of_the_magi Fluffy_Pillow 35058.5/63371: 55% mana arcane_charge
1:38.563 aoe k arcane_power Fluffy_Pillow 34216.3/63371: 54% mana arcane_charge(4)
1:38.563 aoe p arcane_barrage Fluffy_Pillow 34216.3/63371: 54% mana arcane_charge(4), arcane_power, rune_of_power
1:39.870 aoe o arcane_explosion Fluffy_Pillow 38407.7/63371: 61% mana arcane_power, rune_of_power
1:41.175 aoe o arcane_explosion Fluffy_Pillow 37561.7/63371: 59% mana arcane_charge, arcane_power, rune_of_power
1:42.481 aoe o arcane_explosion Fluffy_Pillow 36716.9/63371: 58% mana arcane_charge(2), arcane_power, rune_of_power
1:43.787 aoe o arcane_explosion Fluffy_Pillow 35872.2/63371: 57% mana arcane_charge(3), arcane_power, rune_of_power
1:45.092 aoe p arcane_barrage Fluffy_Pillow 35026.2/63371: 55% mana arcane_charge(4), arcane_power, rune_of_power
1:46.397 aoe m arcane_orb Fluffy_Pillow 39215.0/63371: 62% mana arcane_power, rune_of_power
1:47.704 aoe p arcane_barrage Fluffy_Pillow 40621.6/63371: 64% mana arcane_charge(4), arcane_power, rune_of_power
1:49.011 aoe o arcane_explosion Fluffy_Pillow 44813.0/63371: 71% mana arcane_power, rune_of_power
1:50.316 aoe o arcane_explosion Fluffy_Pillow 43966.9/63371: 69% mana arcane_charge, arcane_power, rune_of_power
1:51.625 aoe o arcane_explosion Fluffy_Pillow 43126.0/63371: 68% mana arcane_charge(2), arcane_power, clearcasting
1:52.930 aoe o arcane_explosion Fluffy_Pillow 44780.0/63371: 71% mana arcane_charge(3), arcane_power
1:54.237 aoe l rune_of_power Fluffy_Pillow 43936.5/63371: 69% mana arcane_charge(4)
1:55.543 aoe p arcane_barrage Fluffy_Pillow 45591.8/63371: 72% mana arcane_charge(4), rune_of_power
1:56.850 aoe o arcane_explosion Fluffy_Pillow 49783.2/63371: 79% mana rune_of_power
1:58.156 aoe o arcane_explosion Fluffy_Pillow 46438.4/63371: 73% mana arcane_charge, rune_of_power
1:59.463 aoe o arcane_explosion Fluffy_Pillow 43095.0/63371: 68% mana arcane_charge(2), rune_of_power
2:00.769 aoe o arcane_explosion Fluffy_Pillow 39750.2/63371: 63% mana arcane_charge(3), rune_of_power
2:02.076 aoe p arcane_barrage Fluffy_Pillow 36406.8/63371: 57% mana arcane_charge(4), rune_of_power
2:03.382 aoe o arcane_explosion Fluffy_Pillow 40596.9/63371: 64% mana rune_of_power
2:04.687 aoe o arcane_explosion Fluffy_Pillow 37250.9/63371: 59% mana arcane_charge, rune_of_power
2:05.994 aoe o arcane_explosion Fluffy_Pillow 33907.4/63371: 54% mana arcane_charge(2), rune_of_power
2:07.299 aoe o arcane_explosion Fluffy_Pillow 30561.4/63371: 48% mana arcane_charge(3), rune_of_power
2:08.605 aoe n shifting_power Fluffy_Pillow 27216.7/63371: 43% mana arcane_charge(4), clearcasting
2:12.312 aoe p arcane_barrage Fluffy_Pillow 29415.0/63371: 46% mana arcane_charge(4), clearcasting
2:13.617 aoe m arcane_orb Fluffy_Pillow 33603.9/63371: 53% mana clearcasting
2:14.923 aoe p arcane_barrage Fluffy_Pillow 34759.1/63371: 55% mana arcane_charge(4), clearcasting
2:16.229 aoe o arcane_explosion Fluffy_Pillow 38949.3/63371: 61% mana clearcasting
2:17.535 aoe o arcane_explosion Fluffy_Pillow 40604.5/63371: 64% mana arcane_charge
2:18.839 aoe o arcane_explosion Fluffy_Pillow 37257.2/63371: 59% mana arcane_charge(2)
2:20.146 aoe o arcane_explosion Fluffy_Pillow 33913.8/63371: 54% mana arcane_charge(3)
2:21.453 shared_cds r use_mana_gem NightFae_Dream 30570.3/63371: 48% mana arcane_charge(4)
2:21.453 aoe p arcane_barrage Fluffy_Pillow 36907.4/63371: 58% mana arcane_charge(4)
2:22.760 aoe o arcane_explosion Fluffy_Pillow 41098.8/63371: 65% mana
2:24.066 aoe o arcane_explosion Fluffy_Pillow 37754.1/63371: 60% mana arcane_charge
2:25.373 aoe o arcane_explosion Fluffy_Pillow 34410.6/63371: 54% mana arcane_charge(2)
2:26.679 aoe o arcane_explosion Fluffy_Pillow 31065.9/63371: 49% mana arcane_charge(3)
2:27.986 aoe p arcane_barrage Fluffy_Pillow 27722.4/63371: 44% mana arcane_charge(4)
2:29.292 aoe j touch_of_the_magi Fluffy_Pillow 31912.5/63371: 50% mana
2:30.600 aoe l rune_of_power Fluffy_Pillow 31070.3/63371: 49% mana arcane_charge(4), clearcasting
2:31.906 aoe p arcane_barrage Fluffy_Pillow 32725.6/63371: 52% mana arcane_charge(4), clearcasting, rune_of_power
2:33.213 aoe o arcane_explosion Fluffy_Pillow 36917.0/63371: 58% mana clearcasting, rune_of_power
2:34.520 aoe o arcane_explosion Fluffy_Pillow 38573.5/63371: 61% mana arcane_charge, rune_of_power
2:35.827 aoe o arcane_explosion Fluffy_Pillow 35230.0/63371: 56% mana arcane_charge(2), clearcasting, rune_of_power
2:37.132 aoe o arcane_explosion Fluffy_Pillow 36884.0/63371: 58% mana arcane_charge(3), rune_of_power
2:38.439 aoe p arcane_barrage Fluffy_Pillow 33540.6/63371: 53% mana arcane_charge(4), clearcasting, rune_of_power
2:39.745 aoe m arcane_orb Fluffy_Pillow 37730.7/63371: 60% mana clearcasting, rune_of_power
2:41.051 aoe p arcane_barrage Fluffy_Pillow 38885.9/63371: 61% mana arcane_charge(4), clearcasting, rune_of_power
2:42.357 aoe o arcane_explosion Fluffy_Pillow 43076.1/63371: 68% mana clearcasting, rune_of_power
2:43.664 aoe o arcane_explosion Fluffy_Pillow 44732.6/63371: 71% mana arcane_charge, rune_of_power
2:44.970 aoe o arcane_explosion Fluffy_Pillow 41387.8/63371: 65% mana arcane_charge(2)
2:46.276 aoe o arcane_explosion Fluffy_Pillow 38043.1/63371: 60% mana arcane_charge(3)
2:47.583 aoe p arcane_barrage Fluffy_Pillow 34699.6/63371: 55% mana arcane_charge(4)
2:48.889 aoe o arcane_explosion Fluffy_Pillow 38889.8/63371: 61% mana
2:50.195 aoe o arcane_explosion Fluffy_Pillow 35545.0/63371: 56% mana arcane_charge
2:51.503 aoe o arcane_explosion Fluffy_Pillow 32202.8/63371: 51% mana arcane_charge(2), clearcasting
2:52.809 aoe o arcane_explosion Fluffy_Pillow 33858.1/63371: 53% mana arcane_charge(3)
2:54.117 aoe n shifting_power Fluffy_Pillow 30515.9/63371: 48% mana arcane_charge(4)
2:57.906 aoe p arcane_barrage Fluffy_Pillow 32818.2/63371: 52% mana arcane_charge(4)
2:59.213 aoe m arcane_orb Fluffy_Pillow 37009.5/63371: 58% mana
3:00.520 aoe p arcane_barrage Fluffy_Pillow 38166.1/63371: 60% mana arcane_charge(4)
3:01.827 aoe o arcane_explosion Fluffy_Pillow 42357.5/63371: 67% mana
3:03.132 aoe o arcane_explosion Fluffy_Pillow 39011.5/63371: 62% mana arcane_charge
3:04.437 aoe o arcane_explosion Fluffy_Pillow 35665.4/63371: 56% mana arcane_charge(2)
3:05.745 aoe o arcane_explosion Fluffy_Pillow 32323.2/63371: 51% mana arcane_charge(3)
3:07.052 aoe p arcane_barrage Fluffy_Pillow 28979.8/63371: 46% mana arcane_charge(4), clearcasting
3:08.360 aoe o arcane_explosion Fluffy_Pillow 33172.4/63371: 52% mana clearcasting
3:09.667 aoe o arcane_explosion Fluffy_Pillow 34829.0/63371: 55% mana arcane_charge
3:10.972 aoe o arcane_explosion Fluffy_Pillow 31483.0/63371: 50% mana arcane_charge(2)
3:12.277 aoe o arcane_explosion Fluffy_Pillow 28136.9/63371: 44% mana arcane_charge(3)
3:13.584 aoe p arcane_barrage Fluffy_Pillow 24793.5/63371: 39% mana arcane_charge(4)
3:14.891 aoe j touch_of_the_magi Fluffy_Pillow 28984.9/63371: 46% mana
3:16.198 aoe k arcane_power Fluffy_Pillow 28141.4/63371: 44% mana arcane_charge(4)
3:16.198 shared_cds t berserking Fluffy_Pillow 28141.4/63371: 44% mana arcane_charge(4), arcane_power, rune_of_power
3:16.198 aoe p arcane_barrage Fluffy_Pillow 28141.4/63371: 44% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:17.387 aoe o arcane_explosion Fluffy_Pillow 32183.2/63371: 51% mana berserking, arcane_power, rune_of_power
3:18.576 aoe o arcane_explosion Fluffy_Pillow 31190.2/63371: 49% mana berserking, arcane_charge, arcane_power, rune_of_power
3:19.765 aoe o arcane_explosion Fluffy_Pillow 30197.2/63371: 48% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:20.954 aoe o arcane_explosion Fluffy_Pillow 29204.1/63371: 46% mana berserking, arcane_charge(3), arcane_power, rune_of_power
3:22.143 aoe p arcane_barrage Fluffy_Pillow 28211.1/63371: 45% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:23.332 aoe m arcane_orb Fluffy_Pillow 32252.9/63371: 51% mana berserking, arcane_power, rune_of_power
3:24.520 aoe p arcane_barrage Fluffy_Pillow 33508.6/63371: 53% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:25.708 aoe o arcane_explosion Fluffy_Pillow 37549.2/63371: 59% mana berserking, arcane_power, rune_of_power
3:26.895 aoe o arcane_explosion Fluffy_Pillow 36553.6/63371: 58% mana berserking, arcane_charge, arcane_power, rune_of_power
3:28.084 aoe o arcane_explosion Fluffy_Pillow 35560.6/63371: 56% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:29.272 aoe o arcane_explosion Fluffy_Pillow 34566.3/63371: 55% mana arcane_charge(3), arcane_power
3:30.577 aoe l rune_of_power Fluffy_Pillow 33720.3/63371: 53% mana arcane_charge(4), arcane_power
3:31.884 aoe p arcane_barrage Fluffy_Pillow 35376.8/63371: 56% mana arcane_charge(4), rune_of_power
3:33.191 aoe o arcane_explosion Fluffy_Pillow 39568.2/63371: 62% mana rune_of_power
3:34.497 aoe o arcane_explosion Fluffy_Pillow 36223.5/63371: 57% mana arcane_charge, rune_of_power
3:35.803 aoe o arcane_explosion Fluffy_Pillow 32878.8/63371: 52% mana arcane_charge(2), rune_of_power
3:37.110 aoe o arcane_explosion Fluffy_Pillow 29535.3/63371: 47% mana arcane_charge(3), rune_of_power
3:38.416 aoe p arcane_barrage Fluffy_Pillow 26190.5/63371: 41% mana arcane_charge(4), rune_of_power
3:39.724 aoe o arcane_explosion Fluffy_Pillow 30383.2/63371: 48% mana rune_of_power
3:41.031 aoe o arcane_explosion Fluffy_Pillow 27039.7/63371: 43% mana arcane_charge, clearcasting, rune_of_power
3:42.337 aoe o arcane_explosion Fluffy_Pillow 28695.0/63371: 45% mana arcane_charge(2), rune_of_power
3:43.643 aoe o arcane_explosion Fluffy_Pillow 25350.3/63371: 40% mana arcane_charge(3), clearcasting, rune_of_power
3:44.948 aoe n shifting_power Fluffy_Pillow 27004.2/63371: 43% mana arcane_charge(4)
3:48.653 aoe p arcane_barrage Fluffy_Pillow 29200.1/63371: 46% mana arcane_charge(4)
3:49.960 aoe m arcane_orb Fluffy_Pillow 33391.5/63371: 53% mana
3:51.269 aoe p arcane_barrage Fluffy_Pillow 34550.5/63371: 55% mana arcane_charge(4)
3:52.575 aoe o arcane_explosion Fluffy_Pillow 38740.6/63371: 61% mana
3:53.882 aoe o arcane_explosion Fluffy_Pillow 35397.2/63371: 56% mana arcane_charge
3:55.186 aoe o arcane_explosion Fluffy_Pillow 32049.9/63371: 51% mana arcane_charge(2)
3:56.492 aoe o arcane_explosion Fluffy_Pillow 28705.2/63371: 45% mana arcane_charge(3)
3:57.799 aoe p arcane_barrage Fluffy_Pillow 25361.7/63371: 40% mana arcane_charge(4)
3:59.106 aoe o arcane_explosion Fluffy_Pillow 29553.1/63371: 47% mana
4:00.413 aoe o arcane_explosion Fluffy_Pillow 26209.6/63371: 41% mana arcane_charge, clearcasting
4:01.718 aoe o arcane_explosion Fluffy_Pillow 27863.6/63371: 44% mana arcane_charge(2)
4:03.022 aoe o arcane_explosion Fluffy_Pillow 24516.3/63371: 39% mana arcane_charge(3), clearcasting
4:04.329 aoe p arcane_barrage Fluffy_Pillow 26172.9/63371: 41% mana arcane_charge(4)
4:05.636 aoe j touch_of_the_magi Fluffy_Pillow 30364.2/63371: 48% mana
4:06.942 aoe l rune_of_power Fluffy_Pillow 29519.5/63371: 47% mana arcane_charge(4)
4:08.249 aoe p arcane_barrage Fluffy_Pillow 31176.0/63371: 49% mana arcane_charge(4), rune_of_power
4:09.554 aoe o arcane_explosion Fluffy_Pillow 35364.9/63371: 56% mana rune_of_power
4:10.859 aoe o arcane_explosion Fluffy_Pillow 32018.9/63371: 51% mana arcane_charge, rune_of_power
4:12.166 aoe o arcane_explosion Fluffy_Pillow 28675.4/63371: 45% mana arcane_charge(2), rune_of_power
4:13.471 aoe o arcane_explosion Fluffy_Pillow 25329.4/63371: 40% mana arcane_charge(3), rune_of_power
4:14.777 aoe p arcane_barrage Fluffy_Pillow 21984.7/63371: 35% mana arcane_charge(4), rune_of_power
4:16.083 aoe m arcane_orb Fluffy_Pillow 26174.8/63371: 41% mana rune_of_power
4:17.392 aoe p arcane_barrage Fluffy_Pillow 27333.8/63371: 43% mana arcane_charge(4), rune_of_power
4:18.698 aoe o arcane_explosion Fluffy_Pillow 31524.0/63371: 50% mana rune_of_power
4:20.006 aoe o arcane_explosion Fluffy_Pillow 28181.8/63371: 44% mana arcane_charge, rune_of_power
4:21.312 shared_cds r use_mana_gem NightFae_Dream 24837.0/63371: 39% mana arcane_charge(2)
4:21.453 aoe o arcane_explosion Fluffy_Pillow 31352.9/63371: 49% mana arcane_charge(2)
4:22.759 aoe o arcane_explosion Fluffy_Pillow 28008.1/63371: 44% mana arcane_charge(3)
4:24.065 aoe p arcane_barrage Fluffy_Pillow 24663.4/63371: 39% mana arcane_charge(4)
4:25.374 aoe o arcane_explosion Fluffy_Pillow 28857.3/63371: 46% mana
4:26.679 aoe o arcane_explosion Fluffy_Pillow 25511.3/63371: 40% mana arcane_charge
4:27.985 aoe o arcane_explosion Fluffy_Pillow 22166.6/63371: 35% mana arcane_charge(2)
4:29.292 aoe o arcane_explosion Fluffy_Pillow 18823.1/63371: 30% mana arcane_charge(3), clearcasting
4:30.600 aoe n shifting_power Fluffy_Pillow 20480.9/63371: 32% mana arcane_charge(4)
4:34.254 aoe p arcane_barrage Fluffy_Pillow 22612.1/63371: 36% mana arcane_charge(4)
4:35.562 aoe m arcane_orb Fluffy_Pillow 26804.7/63371: 42% mana
4:36.869 aoe p arcane_barrage Fluffy_Pillow 27961.3/63371: 44% mana arcane_charge(4)
4:38.177 aoe o arcane_explosion Fluffy_Pillow 32153.9/63371: 51% mana
4:39.483 aoe o arcane_explosion Fluffy_Pillow 28809.2/63371: 45% mana arcane_charge, clearcasting
4:40.788 aoe o arcane_explosion Fluffy_Pillow 30463.2/63371: 48% mana arcane_charge(2)
4:42.095 aoe o arcane_explosion Fluffy_Pillow 27119.7/63371: 43% mana arcane_charge(3)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="NightFae_Dream"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=night_fae
soulbind=arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

NightFae_Dream_SB : 17112 dps, 4652 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17111.7 17111.7 20.5 / 0.120% 1318.1 / 7.7% 9.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
1888.6 1783.9 Mana 0.00% 47.9 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Dream_SB 17112
Arcane Barrage 5704 33.3% 54.4 5.54sec 31471 25418 Direct 271.9 5295 10522 6305 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.44 271.90 0.00 0.00 1.2381 0.0000 1713438.42 1713438.42 0.00% 25418.16 25418.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.67% 219.35 163 272 5294.62 2082 25810 5293.95 4895 5717 1160982 1160982 0.00%
crit 19.33% 52.56 30 82 10522.15 4164 51620 10522.44 7442 14243 552457 552457 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:54.45
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 480 2.8% 41.3 6.93sec 3494 0 Direct 206.3 586 1171 699 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.26 206.32 0.00 0.00 0.0000 0.0000 144181.78 144181.78 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 166.56 119 214 586.31 443 682 586.23 568 607 97644 97644 0.00%
crit 19.27% 39.75 21 63 1170.84 886 1364 1170.60 1050 1289 46538 46538 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 7546 44.1% 142.7 2.08sec 15888 12767 Direct 713.4 2663 5331 3177 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 142.68 713.38 0.00 0.00 1.2444 0.0000 2266783.07 2266783.07 0.00% 12767.16 12767.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 575.86 460 705 2663.18 1958 4221 2663.37 2567 2734 1533613 1533613 0.00%
crit 19.28% 137.52 92 186 5330.92 3916 8442 5331.23 4859 5751 733170 733170 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:142.66
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1474) 0.0% (8.6%) 13.5 22.88sec 32910 26882

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.46 0.00 0.00 0.00 1.2243 0.0000 0.00 0.00 0.00% 26882.18 26882.18

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.45
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1474 8.6% 67.2 22.88sec 6593 0 Direct 67.2 5525 11028 6591 19.4%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 67.18 67.18 0.00 0.00 0.0000 0.0000 442857.01 442857.01 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.64% 54.17 36 73 5525.14 3869 8342 5527.83 5080 5957 299386 299386 0.00%
crit 19.36% 13.00 4 26 11027.94 7739 16685 11029.03 8229 13906 143471 143471 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (87) 0.0% (0.5%) 18.8 9.26sec 1407 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.80 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 87 0.5% 18.8 9.26sec 1407 0 Direct 18.8 1181 2363 1407 19.1%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.80 18.80 0.00 0.00 0.0000 0.0000 26445.37 26445.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.94% 15.22 5 32 1181.41 1164 1195 1181.44 1169 1192 17979 17979 0.00%
crit 19.06% 3.58 0 11 2362.56 2327 2389 2291.62 0 2389 8466 8466 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1520 3040 1824 19.8%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1821.80 1821.80 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.16% 0.80 0 1 1520.16 1520 1520 1218.52 0 1520 1219 1219 0.00%
crit 19.84% 0.20 0 1 3040.32 3040 3040 603.29 0 3040 603 603 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.1%) 1.0 0.00sec 5867 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 147  / 20 0.1% 90.0 1.29sec 65 50 Direct 90.0 55 109 65 19.4%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5867.21 5867.21 0.00% 49.82 49.82
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.63% 72.57 60 83 54.62 43 62 54.63 53 56 3964 3964 0.00%
crit 19.37% 17.43 7 30 109.19 86 124 109.23 95 122 1903 1903 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Shifting Power 665 3.9% 6.1 48.45sec 32902 9218 Periodic 120.7 1389 2779 1656 19.2% 1.3%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.08 0.00 24.14 120.71 3.5695 0.8349 199902.34 199902.34 0.00% 9217.61 9217.61
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.81% 97.54 71 127 1389.44 1372 1409 1389.27 1383 1396 135526 135526 0.00%
crit 19.19% 23.17 10 41 2778.79 2745 2818 2778.39 2751 2805 64377 64377 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:6.08
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (1130) 0.0% (6.6%) 6.6 48.85sec 51094 39110

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.63 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 39109.79 39109.79

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.67
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 1130 6.6% 6.6 48.68sec 51094 0 Direct 33.0 10287 0 10287 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.63 33.00 0.00 0.00 0.0000 0.0000 338886.37 338886.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 33.00 25 40 10287.13 2616 49629 10291.12 8641 13331 338886 338886 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11373.29
  • base_dd_max:11373.29
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
NightFae_Dream_SB
Arcane Power 3.6 97.23sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.57 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.57
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.72sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.3 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.26 0.00 1.51 0.00 4.2218 0.7198 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.26
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.50sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.49
  • if_expr:buff.arcane_power.up
Rune of Power 6.5 47.15sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.48 0.00 0.00 0.00 1.2602 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.50
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 120.72sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.81 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Dream_SB
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.81
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 55.2 174.8 5.5sec 1.3sec 4.1sec 75.62% 0.00% 29.0 (30.1) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 14.7s
  • trigger_min/max:0.0s / 9.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.4s

Stack Uptimes

  • arcane_charge_1:18.17%
  • arcane_charge_2:15.58%
  • arcane_charge_3:14.64%
  • arcane_charge_4:27.23%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.6 0.0 97.2sec 97.2sec 14.7sec 17.48% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 102.1s
  • trigger_min/max:96.0s / 102.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:17.48%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 194.8sec 194.8sec 12.0sec 8.09% 23.63% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:192.7s / 199.3s
  • trigger_min/max:192.7s / 199.3s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.09%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.5 0.2 13.0sec 12.8sec 2.3sec 16.83% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.49%
  • clearcasting_2:0.35%
  • clearcasting_3:0.01%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.3 0.0 0.0sec 0.0sec 4.2sec 0.36% 0.00% 1.0 (1.0) 0.0

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 4.3s

Stack Uptimes

  • evocation_1:0.36%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.5 0.0 300.5sec 300.5sec 23.4sec 11.37% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 301.0s
  • trigger_min/max:300.0s / 301.0s
  • trigger_pct:100.00%
  • duration_min/max:0.4s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.37%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 10.0 0.0 31.1sec 31.1sec 11.8sec 39.32% 0.00% 0.0 (0.0) 9.7

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.4s / 48.9s
  • trigger_min/max:14.4s / 48.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:39.32%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Social Butterfly 30.6 0.0 10.0sec 10.0sec 5.0sec 50.43% 0.00% 0.0 (0.0) 30.1

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_social_butterfly
  • max_stacks:1
  • base duration:5.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:10.0s / 10.0s
  • trigger_min/max:10.0s / 10.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 5.0s

Stack Uptimes

  • social_butterfly_1:50.43%

Spelldata

  • id:320130
  • name:Social Butterfly
  • tooltip:Versatility increased by $w1%.
  • description:{$@spelldesc319210=When at least {$s3=2} allies are within {$s4=8} yd, your Versatility increases by {$320130s1=3}% for {$320130d=5 seconds}. When this expires, {$s3=2} nearby allies gain ${{$320212s1=1}/{$320130s1=3}*100}% of this effect for {$320212d=5 seconds} before passing it back to you.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.65% 0.76% 6.65% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 300.7s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000204.660144.091263.937
Evocation236.04293.277351.305286.879174.326359.937
Rune of Power13.4970.32631.52190.84072.631109.151
Touch of the Magi12.2280.00021.58484.22968.057106.499
Arcane Power1.2320.0046.0874.4012.0769.060
Arcane Barrage3.0340.00312.146166.456132.510200.644
Arcane Orb4.2580.00011.70157.89740.51276.110
Shifting Power7.8570.00030.23247.94543.29357.111

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Dream_SB
mana_regen Mana 693.75 373108.89 69.53% 537.81 7396.43 1.94%
Evocation Mana 12.31 12376.64 2.31% 1005.61 0.00 0.00%
Mana Gem Mana 2.81 17804.06 3.32% 6337.14 0.00 0.00%
Arcane Barrage Mana 54.45 133305.47 24.84% 2448.41 4706.96 3.41%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1783.90 1888.61 12101.7 31888.6 1174.9 63371.4
Usage Type Count Total Avg RPE APR
NightFae_Dream_SB
arcane_explosion Mana 142.7 529281.9 3710.1 3709.7 4.3
arcane_orb Mana 13.5 5854.4 435.2 435.1 75.6
shifting_power Mana 6.1 15186.2 2500.0 2499.5 13.2
touch_of_the_magi Mana 6.6 16595.7 2500.0 2502.1 20.4

Statistics & Data Analysis

Fight Length
NightFae_Dream_SB Fight Length
Count 1018
Mean 300.66
Minimum 240.09
Maximum 359.94
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
NightFae_Dream_SB Damage Per Second
Count 1018
Mean 17111.70
Minimum 16040.41
Maximum 18191.17
Spread ( max - min ) 2150.75
Range [ ( max - min ) / 2 * 100% ] 6.28%
Standard Deviation 333.3023
5th Percentile 16600.01
95th Percentile 17677.11
( 95th Percentile - 5th Percentile ) 1077.10
Mean Distribution
Standard Deviation 10.4463
95.00% Confidence Interval ( 17091.22 - 17132.17 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1458
0.1 Scale Factor Error with Delta=300 949
0.05 Scale Factor Error with Delta=300 3794
0.01 Scale Factor Error with Delta=300 94834
Priority Target DPS
NightFae_Dream_SB Priority Target Damage Per Second
Count 1018
Mean 4651.61
Minimum 4200.45
Maximum 5137.55
Spread ( max - min ) 937.10
Range [ ( max - min ) / 2 * 100% ] 10.07%
Standard Deviation 165.8866
5th Percentile 4394.28
95th Percentile 4941.28
( 95th Percentile - 5th Percentile ) 546.99
Mean Distribution
Standard Deviation 5.1992
95.00% Confidence Interval ( 4641.42 - 4661.80 )
Normalized 95.00% Confidence Interval ( 99.78% - 100.22% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4886
0.1 Scale Factor Error with Delta=300 235
0.05 Scale Factor Error with Delta=300 940
0.01 Scale Factor Error with Delta=300 23492
DPS(e)
NightFae_Dream_SB Damage Per Second (Effective)
Count 1018
Mean 17111.70
Minimum 16040.41
Maximum 18191.17
Spread ( max - min ) 2150.75
Range [ ( max - min ) / 2 * 100% ] 6.28%
Damage
NightFae_Dream_SB Damage
Count 1018
Mean 5134316.17
Minimum 4111838.51
Maximum 6249872.68
Spread ( max - min ) 2138034.16
Range [ ( max - min ) / 2 * 100% ] 20.82%
DTPS
NightFae_Dream_SB Damage Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Dream_SB Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Dream_SB Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Dream_SB Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Dream_SB Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Dream_SB Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_Dream_SBTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Dream_SB Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.67 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.57 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.50 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.45 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 6.08 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 142.66 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 54.45 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.26 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.81 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.49 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjkstpmpoooopoooopoooolpoooorpmpoooonpmpoooopoooopoojlpmpoooopoooopoooonpmpoooopoooopojkpoooopmpoooolpoooopoooonpmpooooporooopjlpoooopmpoooopoooonpmpoooopoooopjktpoooopmpoooolpoooopoooonpmpoooopoooopjlpoooopmpooooproooonpmpoooop

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask NightFae_Dream_SB 63371.4/63371: 100% mana
Pre precombat R food NightFae_Dream_SB 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana social_butterfly
0:01.308 aoe k arcane_power Fluffy_Pillow 60879.0/63371: 96% mana bloodlust, arcane_charge(4), social_butterfly
0:01.308 shared_cds s potion Fluffy_Pillow 60879.0/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, social_butterfly
0:01.308 shared_cds t berserking Fluffy_Pillow 60879.0/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:01.308 aoe p arcane_barrage Fluffy_Pillow 60879.0/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:02.223 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:03.138 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:04.052 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:04.968 aoe o arcane_explosion Fluffy_Pillow 62032.4/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:05.883 aoe o arcane_explosion Fluffy_Pillow 60692.1/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.795 aoe o arcane_explosion Fluffy_Pillow 59348.0/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.708 aoe p arcane_barrage Fluffy_Pillow 58005.1/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.622 aoe o arcane_explosion Fluffy_Pillow 61698.4/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.534 aoe o arcane_explosion Fluffy_Pillow 60354.3/63371: 95% mana bloodlust, berserking, arcane_charge, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:10.448 aoe o arcane_explosion Fluffy_Pillow 61512.8/63371: 97% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:11.364 aoe o arcane_explosion Fluffy_Pillow 60173.7/63371: 95% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:12.280 aoe p arcane_barrage Fluffy_Pillow 58834.7/63371: 93% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:13.194 aoe o arcane_explosion Fluffy_Pillow 62528.0/63371: 99% mana bloodlust, berserking, arcane_power, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:14.107 aoe o arcane_explosion Fluffy_Pillow 61185.1/63371: 97% mana bloodlust, arcane_charge, arcane_power, social_butterfly, potion_of_deathly_fixation
0:15.115 aoe o arcane_explosion Fluffy_Pillow 59962.7/63371: 95% mana bloodlust, arcane_charge(2), arcane_power, potion_of_deathly_fixation
0:16.120 aoe o arcane_explosion Fluffy_Pillow 58736.5/63371: 93% mana bloodlust, arcane_charge(3), arcane_power, potion_of_deathly_fixation
0:17.126 aoe l rune_of_power Fluffy_Pillow 57511.5/63371: 91% mana bloodlust, arcane_charge(4), clearcasting, potion_of_deathly_fixation
0:18.132 aoe p arcane_barrage Fluffy_Pillow 58786.5/63371: 93% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:19.137 aoe o arcane_explosion Fluffy_Pillow 62595.2/63371: 99% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:20.143 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:21.149 aoe o arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge(2), rune_of_power, social_butterfly, potion_of_deathly_fixation
0:22.153 aoe o arcane_explosion Fluffy_Pillow 55919.0/63371: 88% mana bloodlust, arcane_charge(3), rune_of_power, social_butterfly, potion_of_deathly_fixation
0:23.161 shared_cds r use_mana_gem NightFae_Dream_SB 52196.5/63371: 82% mana bloodlust, arcane_charge(4), rune_of_power, social_butterfly, potion_of_deathly_fixation
0:23.161 aoe p arcane_barrage Fluffy_Pillow 58533.7/63371: 92% mana bloodlust, arcane_charge(4), rune_of_power, social_butterfly, potion_of_deathly_fixation
0:24.167 aoe m arcane_orb Fluffy_Pillow 62343.6/63371: 98% mana bloodlust, rune_of_power, social_butterfly, potion_of_deathly_fixation
0:25.175 aoe p arcane_barrage Fluffy_Pillow 63121.1/63371: 100% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:26.181 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:27.187 aoe o arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge, rune_of_power
0:28.195 aoe o arcane_explosion Fluffy_Pillow 55924.0/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power
0:29.201 aoe o arcane_explosion Fluffy_Pillow 52199.1/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power
0:30.208 aoe n shifting_power Fluffy_Pillow 48475.4/63371: 76% mana bloodlust, arcane_charge(4), social_butterfly
0:33.117 aoe p arcane_barrage Fluffy_Pillow 49662.3/63371: 78% mana bloodlust, arcane_charge(4), social_butterfly
0:34.124 aoe m arcane_orb Fluffy_Pillow 53473.5/63371: 84% mana bloodlust, social_butterfly
0:35.130 aoe p arcane_barrage Fluffy_Pillow 54248.5/63371: 86% mana bloodlust, arcane_charge(4)
0:36.138 aoe o arcane_explosion Fluffy_Pillow 58060.9/63371: 92% mana bloodlust
0:37.144 aoe o arcane_explosion Fluffy_Pillow 54336.0/63371: 86% mana bloodlust, arcane_charge
0:38.153 aoe o arcane_explosion Fluffy_Pillow 50614.8/63371: 80% mana bloodlust, arcane_charge(2)
0:39.161 aoe o arcane_explosion Fluffy_Pillow 46892.4/63371: 74% mana bloodlust, arcane_charge(3)
0:40.167 aoe p arcane_barrage Fluffy_Pillow 43167.4/63371: 68% mana bloodlust, arcane_charge(4), social_butterfly
0:41.173 aoe o arcane_explosion Fluffy_Pillow 46977.3/63371: 74% mana social_butterfly
0:42.479 aoe o arcane_explosion Fluffy_Pillow 43632.6/63371: 69% mana arcane_charge, social_butterfly
0:43.786 aoe o arcane_explosion Fluffy_Pillow 40289.1/63371: 64% mana arcane_charge(2), social_butterfly
0:45.094 aoe o arcane_explosion Fluffy_Pillow 36946.9/63371: 58% mana arcane_charge(3)
0:46.401 aoe p arcane_barrage Fluffy_Pillow 33603.4/63371: 53% mana arcane_charge(4), clearcasting
0:47.707 aoe o arcane_explosion Fluffy_Pillow 37793.5/63371: 60% mana clearcasting
0:49.014 aoe o arcane_explosion Fluffy_Pillow 39450.1/63371: 62% mana arcane_charge
0:50.322 aoe j touch_of_the_magi Fluffy_Pillow 36107.9/63371: 57% mana arcane_charge(2), clearcasting, social_butterfly
0:51.629 aoe l rune_of_power Fluffy_Pillow 35264.4/63371: 56% mana arcane_charge(4), clearcasting, social_butterfly
0:52.937 aoe p arcane_barrage Fluffy_Pillow 36922.2/63371: 58% mana arcane_charge(4), clearcasting(2), rune_of_power, social_butterfly
0:54.243 aoe m arcane_orb Fluffy_Pillow 41112.3/63371: 65% mana clearcasting(2), rune_of_power, social_butterfly
0:55.549 aoe p arcane_barrage Fluffy_Pillow 42267.6/63371: 67% mana arcane_charge(4), clearcasting(2), rune_of_power
0:56.855 aoe o arcane_explosion Fluffy_Pillow 46457.7/63371: 73% mana clearcasting(2), rune_of_power
0:58.159 aoe o arcane_explosion Fluffy_Pillow 48110.4/63371: 76% mana arcane_charge, clearcasting, rune_of_power
0:59.465 aoe o arcane_explosion Fluffy_Pillow 49765.7/63371: 79% mana arcane_charge(2), rune_of_power
1:00.772 aoe o arcane_explosion Fluffy_Pillow 46422.2/63371: 73% mana arcane_charge(3), rune_of_power, social_butterfly
1:02.077 aoe p arcane_barrage Fluffy_Pillow 43076.2/63371: 68% mana arcane_charge(4), rune_of_power, social_butterfly
1:03.385 aoe o arcane_explosion Fluffy_Pillow 47268.8/63371: 75% mana rune_of_power, social_butterfly
1:04.692 aoe o arcane_explosion Fluffy_Pillow 43925.4/63371: 69% mana arcane_charge, rune_of_power, social_butterfly
1:05.998 aoe o arcane_explosion Fluffy_Pillow 40580.6/63371: 64% mana arcane_charge(2)
1:07.304 aoe o arcane_explosion Fluffy_Pillow 37235.9/63371: 59% mana arcane_charge(3)
1:08.611 aoe p arcane_barrage Fluffy_Pillow 33892.4/63371: 53% mana arcane_charge(4)
1:09.918 aoe o arcane_explosion Fluffy_Pillow 38083.8/63371: 60% mana
1:11.222 aoe o arcane_explosion Fluffy_Pillow 34736.5/63371: 55% mana arcane_charge, social_butterfly
1:12.529 aoe o arcane_explosion Fluffy_Pillow 31393.1/63371: 50% mana arcane_charge(2), social_butterfly
1:13.835 aoe o arcane_explosion Fluffy_Pillow 28048.3/63371: 44% mana arcane_charge(3), social_butterfly
1:15.142 aoe n shifting_power Fluffy_Pillow 24704.9/63371: 39% mana arcane_charge(4)
1:18.943 aoe p arcane_barrage Fluffy_Pillow 27022.4/63371: 43% mana arcane_charge(4)
1:20.246 aoe m arcane_orb Fluffy_Pillow 31208.7/63371: 49% mana social_butterfly
1:21.553 aoe p arcane_barrage Fluffy_Pillow 32365.2/63371: 51% mana arcane_charge(4), social_butterfly
1:22.860 aoe o arcane_explosion Fluffy_Pillow 36556.6/63371: 58% mana social_butterfly
1:24.167 aoe o arcane_explosion Fluffy_Pillow 33213.1/63371: 52% mana arcane_charge, social_butterfly
1:25.473 aoe o arcane_explosion Fluffy_Pillow 29868.4/63371: 47% mana arcane_charge(2)
1:26.779 aoe o arcane_explosion Fluffy_Pillow 26523.6/63371: 42% mana arcane_charge(3), clearcasting
1:28.085 aoe p arcane_barrage Fluffy_Pillow 28178.9/63371: 44% mana arcane_charge(4)
1:29.392 aoe o arcane_explosion Fluffy_Pillow 32370.3/63371: 51% mana
1:30.699 aoe o arcane_explosion Fluffy_Pillow 29026.8/63371: 46% mana arcane_charge, social_butterfly
1:32.007 aoe o arcane_explosion Fluffy_Pillow 25684.6/63371: 41% mana arcane_charge(2), social_butterfly
1:33.313 aoe o arcane_explosion Fluffy_Pillow 22339.9/63371: 35% mana arcane_charge(3), social_butterfly
1:34.619 aoe p arcane_barrage Fluffy_Pillow 18995.1/63371: 30% mana arcane_charge(4), social_butterfly
1:35.925 aoe o arcane_explosion Fluffy_Pillow 23185.3/63371: 37% mana
1:37.231 aoe j touch_of_the_magi Fluffy_Pillow 19840.5/63371: 31% mana arcane_charge
1:38.537 aoe k arcane_power Fluffy_Pillow 18995.8/63371: 30% mana arcane_charge(4)
1:38.537 aoe p arcane_barrage Fluffy_Pillow 18995.8/63371: 30% mana arcane_charge(4), arcane_power, rune_of_power
1:39.844 aoe o arcane_explosion Fluffy_Pillow 23187.2/63371: 37% mana arcane_power, rune_of_power
1:41.152 aoe o arcane_explosion Fluffy_Pillow 22345.0/63371: 35% mana arcane_charge, arcane_power, rune_of_power, social_butterfly
1:42.457 aoe o arcane_explosion Fluffy_Pillow 21499.0/63371: 34% mana arcane_charge(2), arcane_power, rune_of_power, social_butterfly
1:43.761 aoe o arcane_explosion Fluffy_Pillow 20651.7/63371: 33% mana arcane_charge(3), arcane_power, rune_of_power, social_butterfly
1:45.069 aoe p arcane_barrage Fluffy_Pillow 19809.5/63371: 31% mana arcane_charge(4), arcane_power, rune_of_power
1:46.376 aoe m arcane_orb Fluffy_Pillow 24000.9/63371: 38% mana arcane_power, rune_of_power
1:47.682 aoe p arcane_barrage Fluffy_Pillow 25406.1/63371: 40% mana arcane_charge(4), arcane_power, rune_of_power
1:48.989 aoe o arcane_explosion Fluffy_Pillow 29597.5/63371: 47% mana arcane_power, rune_of_power
1:50.296 aoe o arcane_explosion Fluffy_Pillow 28754.0/63371: 45% mana arcane_charge, arcane_power, rune_of_power, social_butterfly
1:51.602 aoe o arcane_explosion Fluffy_Pillow 27909.3/63371: 44% mana arcane_charge(2), arcane_power, social_butterfly
1:52.910 aoe o arcane_explosion Fluffy_Pillow 27067.1/63371: 43% mana arcane_charge(3), arcane_power, social_butterfly
1:54.216 aoe l rune_of_power Fluffy_Pillow 26222.4/63371: 41% mana arcane_charge(4), social_butterfly
1:55.524 aoe p arcane_barrage Fluffy_Pillow 27880.2/63371: 44% mana arcane_charge(4), rune_of_power
1:56.831 aoe o arcane_explosion Fluffy_Pillow 32071.5/63371: 51% mana rune_of_power
1:58.137 aoe o arcane_explosion Fluffy_Pillow 28726.8/63371: 45% mana arcane_charge, clearcasting, rune_of_power
1:59.443 aoe o arcane_explosion Fluffy_Pillow 30382.1/63371: 48% mana arcane_charge(2), rune_of_power
2:00.749 aoe o arcane_explosion Fluffy_Pillow 27037.3/63371: 43% mana arcane_charge(3), rune_of_power, social_butterfly
2:02.056 aoe p arcane_barrage Fluffy_Pillow 23693.9/63371: 37% mana arcane_charge(4), rune_of_power, social_butterfly
2:03.362 aoe o arcane_explosion Fluffy_Pillow 27884.0/63371: 44% mana rune_of_power, social_butterfly
2:04.670 aoe o arcane_explosion Fluffy_Pillow 24541.8/63371: 39% mana arcane_charge, rune_of_power, social_butterfly
2:05.979 aoe o arcane_explosion Fluffy_Pillow 21200.8/63371: 33% mana arcane_charge(2), rune_of_power
2:07.286 aoe o arcane_explosion Fluffy_Pillow 17857.4/63371: 28% mana arcane_charge(3), rune_of_power
2:08.592 aoe n shifting_power Fluffy_Pillow 14512.6/63371: 23% mana arcane_charge(4), clearcasting
2:12.329 aoe p arcane_barrage Fluffy_Pillow 16749.0/63371: 26% mana arcane_charge(4), clearcasting, social_butterfly
2:13.637 aoe m arcane_orb Fluffy_Pillow 20941.7/63371: 33% mana clearcasting, social_butterfly
2:14.944 aoe p arcane_barrage Fluffy_Pillow 22098.2/63371: 35% mana arcane_charge(4), clearcasting, social_butterfly
2:16.250 aoe o arcane_explosion Fluffy_Pillow 26288.3/63371: 41% mana clearcasting
2:17.555 aoe o arcane_explosion Fluffy_Pillow 27942.3/63371: 44% mana arcane_charge
2:18.862 aoe o arcane_explosion Fluffy_Pillow 24598.8/63371: 39% mana arcane_charge(2)
2:20.169 aoe o arcane_explosion Fluffy_Pillow 21255.4/63371: 34% mana arcane_charge(3), clearcasting, social_butterfly
2:21.475 aoe p arcane_barrage Fluffy_Pillow 22910.6/63371: 36% mana arcane_charge(4), social_butterfly
2:22.780 aoe o arcane_explosion Fluffy_Pillow 27099.5/63371: 43% mana social_butterfly
2:24.086 shared_cds r use_mana_gem NightFae_Dream_SB 23754.7/63371: 37% mana arcane_charge, social_butterfly
2:24.086 aoe o arcane_explosion Fluffy_Pillow 30091.9/63371: 47% mana arcane_charge, social_butterfly
2:25.393 aoe o arcane_explosion Fluffy_Pillow 26748.4/63371: 42% mana arcane_charge(2)
2:26.698 aoe o arcane_explosion Fluffy_Pillow 23402.4/63371: 37% mana arcane_charge(3)
2:28.004 aoe p arcane_barrage Fluffy_Pillow 20057.7/63371: 32% mana arcane_charge(4)
2:29.311 aoe j touch_of_the_magi Fluffy_Pillow 24249.1/63371: 38% mana
2:30.618 aoe l rune_of_power Fluffy_Pillow 23405.6/63371: 37% mana arcane_charge(4), social_butterfly
2:31.927 aoe p arcane_barrage Fluffy_Pillow 25064.6/63371: 40% mana arcane_charge(4), rune_of_power, social_butterfly
2:33.233 aoe o arcane_explosion Fluffy_Pillow 29254.8/63371: 46% mana rune_of_power, social_butterfly
2:34.540 aoe o arcane_explosion Fluffy_Pillow 25911.3/63371: 41% mana arcane_charge, rune_of_power, social_butterfly
2:35.848 aoe o arcane_explosion Fluffy_Pillow 22569.1/63371: 36% mana arcane_charge(2), rune_of_power
2:37.155 aoe o arcane_explosion Fluffy_Pillow 19225.6/63371: 30% mana arcane_charge(3), rune_of_power
2:38.461 aoe p arcane_barrage Fluffy_Pillow 15880.9/63371: 25% mana arcane_charge(4), clearcasting, rune_of_power
2:39.768 aoe m arcane_orb Fluffy_Pillow 20072.3/63371: 32% mana clearcasting, rune_of_power
2:41.075 aoe p arcane_barrage Fluffy_Pillow 21228.8/63371: 33% mana arcane_charge(4), clearcasting, rune_of_power, social_butterfly
2:42.383 aoe o arcane_explosion Fluffy_Pillow 25421.4/63371: 40% mana clearcasting, rune_of_power, social_butterfly
2:43.689 aoe o arcane_explosion Fluffy_Pillow 27076.7/63371: 43% mana arcane_charge, rune_of_power, social_butterfly
2:44.994 aoe o arcane_explosion Fluffy_Pillow 23730.7/63371: 37% mana arcane_charge(2), social_butterfly
2:46.300 aoe o arcane_explosion Fluffy_Pillow 20386.0/63371: 32% mana arcane_charge(3), clearcasting
2:47.607 aoe p arcane_barrage Fluffy_Pillow 22042.5/63371: 35% mana arcane_charge(4)
2:48.916 aoe o arcane_explosion Fluffy_Pillow 26236.4/63371: 41% mana
2:50.223 aoe o arcane_explosion Fluffy_Pillow 22892.9/63371: 36% mana arcane_charge, clearcasting, social_butterfly
2:51.529 aoe o arcane_explosion Fluffy_Pillow 24548.2/63371: 39% mana arcane_charge(2), social_butterfly
2:52.836 aoe o arcane_explosion Fluffy_Pillow 21204.7/63371: 33% mana arcane_charge(3), clearcasting, social_butterfly
2:54.144 aoe n shifting_power Fluffy_Pillow 22862.5/63371: 36% mana arcane_charge(4), social_butterfly
2:57.853 aoe p arcane_barrage Fluffy_Pillow 25063.4/63371: 40% mana arcane_charge(4)
2:59.160 aoe m arcane_orb Fluffy_Pillow 29254.8/63371: 46% mana
3:00.466 aoe p arcane_barrage Fluffy_Pillow 30410.1/63371: 48% mana arcane_charge(4), social_butterfly
3:01.771 aoe o arcane_explosion Fluffy_Pillow 34598.9/63371: 55% mana social_butterfly
3:03.079 aoe o arcane_explosion Fluffy_Pillow 31256.7/63371: 49% mana arcane_charge, clearcasting, social_butterfly
3:04.386 aoe o arcane_explosion Fluffy_Pillow 32913.3/63371: 52% mana arcane_charge(2), social_butterfly
3:05.691 aoe o arcane_explosion Fluffy_Pillow 29567.2/63371: 47% mana arcane_charge(3)
3:06.996 aoe p arcane_barrage Fluffy_Pillow 26221.2/63371: 41% mana arcane_charge(4)
3:08.302 aoe o arcane_explosion Fluffy_Pillow 30411.4/63371: 48% mana
3:09.610 aoe o arcane_explosion Fluffy_Pillow 27069.2/63371: 43% mana arcane_charge
3:10.916 aoe o arcane_explosion Fluffy_Pillow 23724.4/63371: 37% mana arcane_charge(2), clearcasting, social_butterfly
3:12.223 aoe o arcane_explosion Fluffy_Pillow 25380.9/63371: 40% mana arcane_charge(3), social_butterfly
3:13.531 aoe p arcane_barrage Fluffy_Pillow 22038.7/63371: 35% mana arcane_charge(4), social_butterfly
3:14.837 aoe j touch_of_the_magi Fluffy_Pillow 26228.9/63371: 41% mana social_butterfly
3:16.144 aoe k arcane_power Fluffy_Pillow 25385.4/63371: 40% mana arcane_charge(4)
3:16.144 shared_cds t berserking Fluffy_Pillow 25385.4/63371: 40% mana arcane_charge(4), arcane_power, rune_of_power
3:16.144 aoe p arcane_barrage Fluffy_Pillow 25385.4/63371: 40% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:17.334 aoe o arcane_explosion Fluffy_Pillow 29428.5/63371: 46% mana berserking, arcane_power, rune_of_power
3:18.524 aoe o arcane_explosion Fluffy_Pillow 28436.7/63371: 45% mana berserking, arcane_charge, arcane_power, rune_of_power
3:19.712 aoe o arcane_explosion Fluffy_Pillow 27442.4/63371: 43% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:20.901 aoe o arcane_explosion Fluffy_Pillow 26449.4/63371: 42% mana berserking, arcane_charge(3), arcane_power, rune_of_power, social_butterfly
3:22.090 aoe p arcane_barrage Fluffy_Pillow 25456.4/63371: 40% mana berserking, arcane_charge(4), arcane_power, rune_of_power, social_butterfly
3:23.280 aoe m arcane_orb Fluffy_Pillow 29499.5/63371: 47% mana berserking, arcane_power, rune_of_power, social_butterfly
3:24.469 aoe p arcane_barrage Fluffy_Pillow 30756.4/63371: 49% mana berserking, arcane_charge(4), arcane_power, rune_of_power, social_butterfly
3:25.656 aoe o arcane_explosion Fluffy_Pillow 34795.7/63371: 55% mana berserking, arcane_power, rune_of_power
3:26.845 aoe o arcane_explosion Fluffy_Pillow 33802.7/63371: 53% mana berserking, arcane_charge, arcane_power, rune_of_power
3:28.033 aoe o arcane_explosion Fluffy_Pillow 32808.4/63371: 52% mana berserking, arcane_charge(2), arcane_power, rune_of_power
3:29.221 aoe o arcane_explosion Fluffy_Pillow 31814.1/63371: 50% mana arcane_charge(3), arcane_power
3:30.528 aoe l rune_of_power Fluffy_Pillow 30970.7/63371: 49% mana arcane_charge(4), arcane_power, social_butterfly
3:31.834 aoe p arcane_barrage Fluffy_Pillow 32625.9/63371: 51% mana arcane_charge(4), rune_of_power, social_butterfly
3:33.138 aoe o arcane_explosion Fluffy_Pillow 36813.5/63371: 58% mana rune_of_power, social_butterfly
3:34.446 aoe o arcane_explosion Fluffy_Pillow 33471.3/63371: 53% mana arcane_charge, rune_of_power, social_butterfly
3:35.752 aoe o arcane_explosion Fluffy_Pillow 30126.6/63371: 48% mana arcane_charge(2), rune_of_power
3:37.058 aoe o arcane_explosion Fluffy_Pillow 26781.8/63371: 42% mana arcane_charge(3), rune_of_power
3:38.363 aoe p arcane_barrage Fluffy_Pillow 23435.8/63371: 37% mana arcane_charge(4), rune_of_power
3:39.670 aoe o arcane_explosion Fluffy_Pillow 27627.2/63371: 44% mana rune_of_power
3:40.976 aoe o arcane_explosion Fluffy_Pillow 24282.5/63371: 38% mana arcane_charge, rune_of_power, social_butterfly
3:42.280 aoe o arcane_explosion Fluffy_Pillow 20935.2/63371: 33% mana arcane_charge(2), rune_of_power, social_butterfly
3:43.587 aoe o arcane_explosion Fluffy_Pillow 17591.7/63371: 28% mana arcane_charge(3), rune_of_power, social_butterfly
3:44.893 aoe n shifting_power Fluffy_Pillow 14247.0/63371: 22% mana arcane_charge(4), clearcasting, social_butterfly
3:48.547 aoe p arcane_barrage Fluffy_Pillow 16378.2/63371: 26% mana arcane_charge(4), clearcasting
3:49.853 aoe m arcane_orb Fluffy_Pillow 20568.3/63371: 32% mana clearcasting
3:51.158 aoe p arcane_barrage Fluffy_Pillow 21722.3/63371: 34% mana arcane_charge(4), clearcasting, social_butterfly
3:52.464 aoe o arcane_explosion Fluffy_Pillow 25912.4/63371: 41% mana clearcasting, social_butterfly
3:53.771 aoe o arcane_explosion Fluffy_Pillow 27568.9/63371: 44% mana arcane_charge, social_butterfly
3:55.078 aoe o arcane_explosion Fluffy_Pillow 24225.5/63371: 38% mana arcane_charge(2)
3:56.385 aoe o arcane_explosion Fluffy_Pillow 20882.0/63371: 33% mana arcane_charge(3)
3:57.692 aoe p arcane_barrage Fluffy_Pillow 17538.5/63371: 28% mana arcane_charge(4), clearcasting
3:58.998 aoe o arcane_explosion Fluffy_Pillow 21728.6/63371: 34% mana clearcasting
4:00.306 aoe o arcane_explosion Fluffy_Pillow 23386.4/63371: 37% mana arcane_charge, social_butterfly
4:01.613 aoe o arcane_explosion Fluffy_Pillow 20043.0/63371: 32% mana arcane_charge(2), social_butterfly
4:02.920 aoe o arcane_explosion Fluffy_Pillow 16699.5/63371: 26% mana arcane_charge(3), social_butterfly
4:04.228 aoe p arcane_barrage Fluffy_Pillow 13357.3/63371: 21% mana arcane_charge(4), social_butterfly
4:05.534 aoe j touch_of_the_magi Fluffy_Pillow 17547.4/63371: 28% mana
4:06.842 aoe l rune_of_power Fluffy_Pillow 16705.2/63371: 26% mana arcane_charge(4), clearcasting
4:08.149 aoe p arcane_barrage Fluffy_Pillow 18361.7/63371: 29% mana arcane_charge(4), clearcasting, rune_of_power
4:09.457 aoe o arcane_explosion Fluffy_Pillow 22554.4/63371: 36% mana clearcasting, rune_of_power
4:10.764 aoe o arcane_explosion Fluffy_Pillow 24210.9/63371: 38% mana arcane_charge, rune_of_power, social_butterfly
4:12.071 aoe o arcane_explosion Fluffy_Pillow 20867.4/63371: 33% mana arcane_charge(2), rune_of_power, social_butterfly
4:13.377 aoe o arcane_explosion Fluffy_Pillow 17522.7/63371: 28% mana arcane_charge(3), rune_of_power, social_butterfly
4:14.682 aoe p arcane_barrage Fluffy_Pillow 14176.7/63371: 22% mana arcane_charge(4), rune_of_power, social_butterfly
4:15.989 aoe m arcane_orb Fluffy_Pillow 18368.1/63371: 29% mana rune_of_power
4:17.294 aoe p arcane_barrage Fluffy_Pillow 19522.1/63371: 31% mana arcane_charge(4), rune_of_power
4:18.599 aoe o arcane_explosion Fluffy_Pillow 23710.9/63371: 37% mana rune_of_power
4:19.907 aoe o arcane_explosion Fluffy_Pillow 20368.7/63371: 32% mana arcane_charge, clearcasting, rune_of_power
4:21.213 aoe o arcane_explosion Fluffy_Pillow 22024.0/63371: 35% mana arcane_charge(2), social_butterfly
4:22.523 aoe o arcane_explosion Fluffy_Pillow 18684.3/63371: 29% mana arcane_charge(3), social_butterfly
4:23.830 aoe p arcane_barrage Fluffy_Pillow 15340.8/63371: 24% mana arcane_charge(4), social_butterfly
4:25.136 shared_cds r use_mana_gem NightFae_Dream_SB 19531.0/63371: 31% mana
4:25.136 aoe o arcane_explosion Fluffy_Pillow 25868.1/63371: 41% mana
4:26.443 aoe o arcane_explosion Fluffy_Pillow 22524.6/63371: 36% mana arcane_charge, clearcasting
4:27.750 aoe o arcane_explosion Fluffy_Pillow 24181.2/63371: 38% mana arcane_charge(2)
4:29.056 aoe o arcane_explosion Fluffy_Pillow 20836.4/63371: 33% mana arcane_charge(3)
4:30.361 aoe n shifting_power Fluffy_Pillow 17490.4/63371: 28% mana arcane_charge(4), social_butterfly
4:34.073 aoe p arcane_barrage Fluffy_Pillow 19695.1/63371: 31% mana arcane_charge(4), social_butterfly
4:35.380 aoe m arcane_orb Fluffy_Pillow 23886.5/63371: 38% mana
4:36.689 aoe p arcane_barrage Fluffy_Pillow 25045.6/63371: 40% mana arcane_charge(4)
4:37.995 aoe o arcane_explosion Fluffy_Pillow 29235.7/63371: 46% mana
4:39.300 aoe o arcane_explosion Fluffy_Pillow 25889.7/63371: 41% mana arcane_charge
4:40.608 aoe o arcane_explosion Fluffy_Pillow 22547.5/63371: 36% mana arcane_charge(2), social_butterfly
4:41.914 aoe o arcane_explosion Fluffy_Pillow 19202.7/63371: 30% mana arcane_charge(3), social_butterfly
4:43.220 aoe p arcane_barrage Fluffy_Pillow 15858.0/63371: 25% mana arcane_charge(4), social_butterfly

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="NightFae_Dream_SB"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=night_fae
soulbind=319210//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

NightFae_Koraylon : 17374 dps, 4733 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17373.7 17373.7 21.4 / 0.123% 1328.9 / 7.6% 9.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
1890.1 1786.1 Mana 0.00% 47.9 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Koraylon 17374
Arcane Barrage 5763 33.2% 54.4 5.54sec 31799 25683 Direct 271.8 5321 10710 6371 19.5%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.44 271.79 0.00 0.00 1.2381 0.0000 1731076.38 1731076.38 0.00% 25683.24 25683.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.51% 218.82 167 274 5320.90 2082 25140 5320.61 4868 5827 1163965 1163965 0.00%
crit 19.49% 52.96 26 88 10709.79 4164 50280 10718.99 8180 14504 567111 567111 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:54.44
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 491 2.8% 41.2 6.96sec 3573 0 Direct 206.1 600 1199 715 19.2%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.21 206.07 0.00 0.00 0.0000 0.0000 147238.62 147238.62 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.82% 166.54 120 215 599.67 443 731 599.85 578 624 99861 99861 0.00%
crit 19.18% 39.53 19 61 1198.72 886 1462 1199.11 1097 1332 47377 47377 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 7673 44.2% 142.6 2.08sec 16161 12987 Direct 713.1 2708 5419 3232 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 142.62 713.08 0.00 0.00 1.2444 0.0000 2304819.52 2304819.52 0.00% 12987.09 12987.09
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 575.18 447 700 2707.77 1958 4523 2708.56 2599 2786 1557609 1557609 0.00%
crit 19.34% 137.90 93 185 5418.56 3916 9045 5419.44 5017 5895 747211 747211 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:142.60
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1495) 0.0% (8.6%) 13.5 22.94sec 33352 27240

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.46 0.00 0.00 0.00 1.2244 0.0000 0.00 0.00 0.00% 27239.65 27239.65

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.46
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1495 8.6% 67.2 22.93sec 6683 0 Direct 67.2 5600 11185 6682 19.4%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 67.18 67.18 0.00 0.00 0.0000 0.0000 448936.67 448936.67 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.60% 54.15 36 74 5599.79 3869 8938 5601.37 5111 5968 303234 303234 0.00%
crit 19.40% 13.03 4 27 11184.95 7739 17876 11182.68 8375 15065 145703 145703 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (92) 0.0% (0.5%) 18.8 9.20sec 1494 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.76 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 92 0.5% 18.8 9.20sec 1494 0 Direct 18.8 1253 2504 1494 19.3%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.76 18.76 0.00 0.00 0.0000 0.0000 28041.45 28041.45 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 15.14 6 28 1253.36 1164 1280 1258.97 1206 1280 18974 18974 0.00%
crit 19.30% 3.62 0 12 2504.29 2327 2560 2432.95 0 2560 9068 9068 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1629 3257 1928 18.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1926.33 1926.33 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.73% 0.82 0 1 1628.74 1629 1629 1331.15 0 1629 1331 1331 0.00%
crit 18.27% 0.18 0 1 3257.49 3257 3257 595.18 0 3257 595 595 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.1%) 1.0 0.00sec 5800 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 145  / 20 0.1% 90.0 1.29sec 64 49 Direct 90.0 54 108 64 19.5%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5799.81 5799.81 0.00% 49.24 49.24
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.54% 72.49 61 83 53.91 43 60 53.91 53 56 3908 3908 0.00%
crit 19.46% 17.51 7 29 108.05 86 120 108.08 97 119 1892 1892 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Shifting Power 672 3.9% 6.1 48.44sec 33288 9327 Periodic 120.7 1405 2809 1676 19.3% 1.3%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.08 0.00 24.14 120.68 3.5691 0.8349 202243.44 202243.44 0.00% 9326.85 9326.85
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.71% 97.40 69 125 1404.84 1372 1510 1404.45 1388 1426 136848 136848 0.00%
crit 19.29% 23.28 10 41 2809.22 2745 3019 2808.30 2745 2900 65395 65395 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:6.07
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (1161) 0.0% (6.7%) 6.6 48.84sec 52465 40157

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.63 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 40157.01 40157.01

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.68
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 1161 6.7% 6.6 48.66sec 52465 0 Direct 33.0 10560 0 10560 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.63 32.98 0.00 0.00 0.0000 0.0000 348081.00 348081.00 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 32.98 25 40 10560.27 2616 51309 10586.83 8530 13766 348081 348081 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16809.58
  • base_dd_max:16809.58
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
NightFae_Koraylon
Arcane Power 3.6 97.22sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.57 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.57
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.75sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.3 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.27 0.00 1.61 0.00 4.2878 0.7217 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Koraylon
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.27
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Koraylon
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Koraylon
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.51sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.49 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.49
  • if_expr:buff.arcane_power.up
Rune of Power 6.5 47.14sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.48 0.00 0.00 0.00 1.2601 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.50
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 120.73sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.80 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Koraylon
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.81
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 55.2 174.7 5.5sec 1.3sec 4.1sec 75.63% 0.00% 29.0 (30.1) 0.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 14.8s
  • trigger_min/max:0.0s / 9.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.4s

Stack Uptimes

  • arcane_charge_1:18.16%
  • arcane_charge_2:15.59%
  • arcane_charge_3:14.63%
  • arcane_charge_4:27.25%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.6 0.0 97.2sec 97.2sec 14.7sec 17.47% 0.00% 0.0 (0.0) 3.4

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 102.1s
  • trigger_min/max:96.0s / 102.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:17.47%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 194.8sec 194.8sec 12.0sec 8.09% 23.63% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:192.6s / 199.3s
  • trigger_min/max:192.6s / 199.3s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.09%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.3 0.2 13.0sec 12.9sec 2.3sec 16.81% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.48%
  • clearcasting_2:0.35%
  • clearcasting_3:0.12%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.3 0.0 0.0sec 0.0sec 4.3sec 0.38% 0.00% 1.1 (1.1) 0.0

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 4.3s

Stack Uptimes

  • evocation_1:0.39%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.5 0.0 300.5sec 300.5sec 23.4sec 11.37% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 301.0s
  • trigger_min/max:300.0s / 301.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.37%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 10.0 0.0 31.1sec 31.1sec 11.8sec 39.31% 0.00% 0.0 (0.0) 9.7

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.4s / 48.9s
  • trigger_min/max:14.4s / 48.9s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:39.31%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.68% 0.76% 5.69% 0.9s 0.0s 3.6s
Conserve Phase 100.00% 100.00% 100.00% 300.7s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000204.660144.091263.937
Evocation232.89292.037351.271285.918175.166359.937
Rune of Power13.4980.03331.55190.84571.768109.202
Touch of the Magi12.2340.00021.57984.28868.056106.732
Arcane Power1.2330.0036.0894.4001.9949.112
Arcane Barrage3.0350.00212.126166.496132.669199.791
Arcane Orb4.2540.00013.26757.88841.84177.039
Shifting Power7.8550.00030.23047.94042.83357.167

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Koraylon
mana_regen Mana 694.26 373035.79 69.45% 537.32 7470.50 1.96%
Evocation Mana 12.98 13046.93 2.43% 1005.11 0.00 0.00%
Mana Gem Mana 2.80 17773.42 3.31% 6337.14 0.00 0.00%
Arcane Barrage Mana 54.44 133262.17 24.81% 2447.70 4745.36 3.44%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1786.06 1890.07 12227.3 32101.1 89.3 63371.4
Usage Type Count Total Avg RPE APR
NightFae_Koraylon
arcane_explosion Mana 142.6 529647.0 3714.2 3713.8 4.4
arcane_orb Mana 13.5 5856.9 435.1 435.1 76.7
shifting_power Mana 6.1 15186.2 2500.0 2499.5 13.3
touch_of_the_magi Mana 6.6 16600.6 2500.0 2502.1 21.0

Statistics & Data Analysis

Fight Length
NightFae_Koraylon Fight Length
Count 1018
Mean 300.66
Minimum 240.09
Maximum 359.94
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
NightFae_Koraylon Damage Per Second
Count 1018
Mean 17373.67
Minimum 16485.99
Maximum 18421.42
Spread ( max - min ) 1935.44
Range [ ( max - min ) / 2 * 100% ] 5.57%
Standard Deviation 349.1599
5th Percentile 16832.94
95th Percentile 17990.59
( 95th Percentile - 5th Percentile ) 1157.64
Mean Distribution
Standard Deviation 10.9434
95.00% Confidence Interval ( 17352.22 - 17395.11 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1552
0.1 Scale Factor Error with Delta=300 1041
0.05 Scale Factor Error with Delta=300 4163
0.01 Scale Factor Error with Delta=300 104072
Priority Target DPS
NightFae_Koraylon Priority Target Damage Per Second
Count 1018
Mean 4733.26
Minimum 4317.70
Maximum 5407.69
Spread ( max - min ) 1089.99
Range [ ( max - min ) / 2 * 100% ] 11.51%
Standard Deviation 168.3416
5th Percentile 4476.79
95th Percentile 5022.45
( 95th Percentile - 5th Percentile ) 545.66
Mean Distribution
Standard Deviation 5.2762
95.00% Confidence Interval ( 4722.92 - 4743.60 )
Normalized 95.00% Confidence Interval ( 99.78% - 100.22% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 49
0.1% Error 4860
0.1 Scale Factor Error with Delta=300 242
0.05 Scale Factor Error with Delta=300 968
0.01 Scale Factor Error with Delta=300 24192
DPS(e)
NightFae_Koraylon Damage Per Second (Effective)
Count 1018
Mean 17373.67
Minimum 16485.99
Maximum 18421.42
Spread ( max - min ) 1935.44
Range [ ( max - min ) / 2 * 100% ] 5.57%
Damage
NightFae_Koraylon Damage
Count 1018
Mean 5212363.41
Minimum 4156546.07
Maximum 6316450.15
Spread ( max - min ) 2159904.08
Range [ ( max - min ) / 2 * 100% ] 20.72%
DTPS
NightFae_Koraylon Damage Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Koraylon Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Koraylon Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Koraylon Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Koraylon Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Koraylon Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_KoraylonTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Koraylon Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.68 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.57 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.50 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.46 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 6.07 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 142.60 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 54.44 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.27 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.81 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.49 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjkstpmpoooopoooopoooolpoooorpmpoooonpmpoooopoooopoojlpmpoooopoooopoooonpmpoooopoooopojkpoooopmpoooolpoooopoooonpmpooooporooopjlpoooopmpoooopoooonpmpoooopoooopjktpoooopmpoooolpoooopoooonpmpoooopoooopjlpoooopmpoooorpoooonpmpoooo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask NightFae_Koraylon 63371.4/63371: 100% mana
Pre precombat R food NightFae_Koraylon 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana
0:01.306 aoe k arcane_power Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4)
0:01.306 shared_cds s potion Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:01.306 shared_cds t berserking Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:01.306 aoe p arcane_barrage Fluffy_Pillow 60876.5/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.220 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.135 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:04.049 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:04.963 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.879 aoe o arcane_explosion Fluffy_Pillow 62032.4/63371: 98% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.795 aoe o arcane_explosion Fluffy_Pillow 60693.4/63371: 96% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.709 aoe p arcane_barrage Fluffy_Pillow 59351.8/63371: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.624 aoe o arcane_explosion Fluffy_Pillow 63046.3/63371: 99% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.539 aoe o arcane_explosion Fluffy_Pillow 61706.0/63371: 97% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.454 aoe o arcane_explosion Fluffy_Pillow 60365.7/63371: 95% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.368 aoe o arcane_explosion Fluffy_Pillow 59024.2/63371: 93% mana bloodlust, berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:12.282 aoe p arcane_barrage Fluffy_Pillow 60182.6/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.196 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.110 aoe o arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, arcane_charge, arcane_power, potion_of_deathly_fixation
0:15.116 aoe o arcane_explosion Fluffy_Pillow 60804.9/63371: 96% mana bloodlust, arcane_charge(2), arcane_power, potion_of_deathly_fixation
0:16.122 aoe o arcane_explosion Fluffy_Pillow 59579.9/63371: 94% mana bloodlust, arcane_charge(3), arcane_power, potion_of_deathly_fixation
0:17.128 aoe l rune_of_power Fluffy_Pillow 58355.0/63371: 92% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:18.135 aoe p arcane_barrage Fluffy_Pillow 59631.3/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:19.141 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:20.147 aoe o arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:21.154 aoe o arcane_explosion Fluffy_Pillow 55922.8/63371: 88% mana bloodlust, arcane_charge(2), clearcasting, rune_of_power, potion_of_deathly_fixation
0:22.160 aoe o arcane_explosion Fluffy_Pillow 57197.8/63371: 90% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.166 shared_cds r use_mana_gem NightFae_Koraylon 53472.8/63371: 84% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:23.166 aoe p arcane_barrage Fluffy_Pillow 59810.0/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:24.172 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:25.179 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:26.187 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:27.193 aoe o arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge, rune_of_power
0:28.200 aoe o arcane_explosion Fluffy_Pillow 55922.8/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power
0:29.206 aoe o arcane_explosion Fluffy_Pillow 52197.8/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power
0:30.212 aoe n shifting_power Fluffy_Pillow 48472.8/63371: 76% mana bloodlust, arcane_charge(4)
0:33.045 aoe p arcane_barrage Fluffy_Pillow 49563.5/63371: 78% mana bloodlust, arcane_charge(4)
0:34.052 aoe m arcane_orb Fluffy_Pillow 53374.6/63371: 84% mana bloodlust
0:35.059 aoe p arcane_barrage Fluffy_Pillow 54150.9/63371: 85% mana bloodlust, arcane_charge(4), clearcasting
0:36.066 aoe o arcane_explosion Fluffy_Pillow 57962.1/63371: 91% mana bloodlust, clearcasting
0:37.073 aoe o arcane_explosion Fluffy_Pillow 59238.4/63371: 93% mana bloodlust, arcane_charge
0:38.080 aoe o arcane_explosion Fluffy_Pillow 55514.7/63371: 88% mana bloodlust, arcane_charge(2)
0:39.088 aoe o arcane_explosion Fluffy_Pillow 51792.2/63371: 82% mana bloodlust, arcane_charge(3)
0:40.095 aoe p arcane_barrage Fluffy_Pillow 48068.5/63371: 76% mana bloodlust, arcane_charge(4), clearcasting
0:41.100 aoe o arcane_explosion Fluffy_Pillow 51877.2/63371: 82% mana clearcasting
0:42.405 aoe o arcane_explosion Fluffy_Pillow 53531.2/63371: 84% mana arcane_charge
0:43.709 aoe o arcane_explosion Fluffy_Pillow 50183.9/63371: 79% mana arcane_charge(2)
0:45.014 aoe o arcane_explosion Fluffy_Pillow 46837.9/63371: 74% mana arcane_charge(3)
0:46.320 aoe p arcane_barrage Fluffy_Pillow 43493.1/63371: 69% mana arcane_charge(4), clearcasting
0:47.626 aoe o arcane_explosion Fluffy_Pillow 47683.3/63371: 75% mana clearcasting
0:48.933 aoe o arcane_explosion Fluffy_Pillow 49339.8/63371: 78% mana arcane_charge
0:50.239 aoe j touch_of_the_magi Fluffy_Pillow 45995.0/63371: 73% mana arcane_charge(2)
0:51.545 aoe l rune_of_power Fluffy_Pillow 45150.3/63371: 71% mana arcane_charge(4)
0:52.853 aoe p arcane_barrage Fluffy_Pillow 46808.1/63371: 74% mana arcane_charge(4), rune_of_power
0:54.159 aoe m arcane_orb Fluffy_Pillow 50998.2/63371: 80% mana rune_of_power
0:55.465 aoe p arcane_barrage Fluffy_Pillow 52153.5/63371: 82% mana arcane_charge(4), rune_of_power
0:56.772 aoe o arcane_explosion Fluffy_Pillow 56344.9/63371: 89% mana rune_of_power
0:58.079 aoe o arcane_explosion Fluffy_Pillow 53001.4/63371: 84% mana arcane_charge, rune_of_power
0:59.387 aoe o arcane_explosion Fluffy_Pillow 49659.2/63371: 78% mana arcane_charge(2), rune_of_power
1:00.692 aoe o arcane_explosion Fluffy_Pillow 46313.2/63371: 73% mana arcane_charge(3), rune_of_power
1:01.999 aoe p arcane_barrage Fluffy_Pillow 42969.7/63371: 68% mana arcane_charge(4), rune_of_power
1:03.307 aoe o arcane_explosion Fluffy_Pillow 47162.4/63371: 74% mana rune_of_power
1:04.615 aoe o arcane_explosion Fluffy_Pillow 43820.2/63371: 69% mana arcane_charge, rune_of_power
1:05.922 aoe o arcane_explosion Fluffy_Pillow 40476.7/63371: 64% mana arcane_charge(2)
1:07.228 aoe o arcane_explosion Fluffy_Pillow 37132.0/63371: 59% mana arcane_charge(3)
1:08.536 aoe p arcane_barrage Fluffy_Pillow 33789.8/63371: 53% mana arcane_charge(4)
1:09.843 aoe o arcane_explosion Fluffy_Pillow 37981.1/63371: 60% mana
1:11.149 aoe o arcane_explosion Fluffy_Pillow 34636.4/63371: 55% mana arcane_charge
1:12.455 aoe o arcane_explosion Fluffy_Pillow 31291.7/63371: 49% mana arcane_charge(2)
1:13.762 aoe o arcane_explosion Fluffy_Pillow 27948.2/63371: 44% mana arcane_charge(3)
1:15.069 aoe n shifting_power Fluffy_Pillow 24604.7/63371: 39% mana arcane_charge(4)
1:18.988 aoe p arcane_barrage Fluffy_Pillow 27071.8/63371: 43% mana arcane_charge(4)
1:20.295 aoe m arcane_orb Fluffy_Pillow 31263.2/63371: 49% mana
1:21.600 aoe p arcane_barrage Fluffy_Pillow 32417.2/63371: 51% mana arcane_charge(4)
1:22.906 aoe o arcane_explosion Fluffy_Pillow 36607.3/63371: 58% mana
1:24.213 aoe o arcane_explosion Fluffy_Pillow 33263.8/63371: 52% mana arcane_charge
1:25.518 aoe o arcane_explosion Fluffy_Pillow 29917.8/63371: 47% mana arcane_charge(2)
1:26.824 aoe o arcane_explosion Fluffy_Pillow 26573.1/63371: 42% mana arcane_charge(3)
1:28.131 aoe p arcane_barrage Fluffy_Pillow 23229.6/63371: 37% mana arcane_charge(4)
1:29.437 aoe o arcane_explosion Fluffy_Pillow 27419.7/63371: 43% mana
1:30.743 aoe o arcane_explosion Fluffy_Pillow 24075.0/63371: 38% mana arcane_charge
1:32.051 aoe o arcane_explosion Fluffy_Pillow 20732.8/63371: 33% mana arcane_charge(2)
1:33.357 aoe o arcane_explosion Fluffy_Pillow 17388.0/63371: 27% mana arcane_charge(3)
1:34.664 aoe p arcane_barrage Fluffy_Pillow 14044.6/63371: 22% mana arcane_charge(4)
1:35.970 aoe o arcane_explosion Fluffy_Pillow 18234.7/63371: 29% mana
1:37.276 aoe j touch_of_the_magi Fluffy_Pillow 14889.9/63371: 23% mana arcane_charge
1:38.584 aoe k arcane_power Fluffy_Pillow 14047.7/63371: 22% mana arcane_charge(4)
1:38.584 aoe p arcane_barrage Fluffy_Pillow 14047.7/63371: 22% mana arcane_charge(4), arcane_power, rune_of_power
1:39.891 aoe o arcane_explosion Fluffy_Pillow 18239.1/63371: 29% mana arcane_power, rune_of_power
1:41.197 aoe o arcane_explosion Fluffy_Pillow 17394.4/63371: 27% mana arcane_charge, arcane_power, rune_of_power
1:42.502 aoe o arcane_explosion Fluffy_Pillow 16548.4/63371: 26% mana arcane_charge(2), arcane_power, rune_of_power
1:43.808 aoe o arcane_explosion Fluffy_Pillow 15703.6/63371: 25% mana arcane_charge(3), arcane_power, rune_of_power
1:45.113 aoe p arcane_barrage Fluffy_Pillow 14857.6/63371: 23% mana arcane_charge(4), arcane_power, rune_of_power
1:46.419 aoe m arcane_orb Fluffy_Pillow 19047.8/63371: 30% mana arcane_power, rune_of_power
1:47.726 aoe p arcane_barrage Fluffy_Pillow 20454.3/63371: 32% mana arcane_charge(4), arcane_power, rune_of_power
1:49.034 aoe o arcane_explosion Fluffy_Pillow 24646.9/63371: 39% mana arcane_power, rune_of_power
1:50.341 aoe o arcane_explosion Fluffy_Pillow 23803.5/63371: 38% mana arcane_charge, arcane_power, rune_of_power
1:51.649 aoe o arcane_explosion Fluffy_Pillow 22961.3/63371: 36% mana arcane_charge(2), arcane_power
1:52.955 aoe o arcane_explosion Fluffy_Pillow 22116.5/63371: 35% mana arcane_charge(3), arcane_power
1:54.263 aoe l rune_of_power Fluffy_Pillow 21274.3/63371: 34% mana arcane_charge(4)
1:55.572 aoe p arcane_barrage Fluffy_Pillow 22933.4/63371: 36% mana arcane_charge(4), rune_of_power
1:56.878 aoe o arcane_explosion Fluffy_Pillow 27123.5/63371: 43% mana rune_of_power
1:58.186 aoe o arcane_explosion Fluffy_Pillow 23781.3/63371: 38% mana arcane_charge, rune_of_power
1:59.491 aoe o arcane_explosion Fluffy_Pillow 20435.3/63371: 32% mana arcane_charge(2), rune_of_power
2:00.799 aoe o arcane_explosion Fluffy_Pillow 17093.1/63371: 27% mana arcane_charge(3), rune_of_power
2:02.105 aoe p arcane_barrage Fluffy_Pillow 13748.4/63371: 22% mana arcane_charge(4), rune_of_power
2:03.411 aoe o arcane_explosion Fluffy_Pillow 17938.5/63371: 28% mana rune_of_power
2:04.717 aoe o arcane_explosion Fluffy_Pillow 14593.7/63371: 23% mana arcane_charge, rune_of_power
2:06.023 aoe o arcane_explosion Fluffy_Pillow 11249.0/63371: 18% mana arcane_charge(2), clearcasting, rune_of_power
2:07.330 aoe o arcane_explosion Fluffy_Pillow 12905.5/63371: 20% mana arcane_charge(3), rune_of_power
2:08.636 aoe n shifting_power Fluffy_Pillow 9560.8/63371: 15% mana arcane_charge(4)
2:12.421 aoe p arcane_barrage Fluffy_Pillow 11858.0/63371: 19% mana arcane_charge(4)
2:13.726 aoe m arcane_orb Fluffy_Pillow 16046.9/63371: 25% mana
2:15.034 aoe p arcane_barrage Fluffy_Pillow 17204.7/63371: 27% mana arcane_charge(4)
2:16.340 aoe o arcane_explosion Fluffy_Pillow 21394.8/63371: 34% mana
2:17.645 aoe o arcane_explosion Fluffy_Pillow 18048.8/63371: 28% mana arcane_charge
2:18.952 aoe o arcane_explosion Fluffy_Pillow 14705.3/63371: 23% mana arcane_charge(2)
2:20.259 aoe o arcane_explosion Fluffy_Pillow 11361.8/63371: 18% mana arcane_charge(3), clearcasting
2:21.565 aoe p arcane_barrage Fluffy_Pillow 13017.1/63371: 21% mana arcane_charge(4)
2:22.871 aoe o arcane_explosion Fluffy_Pillow 17207.2/63371: 27% mana
2:24.177 shared_cds r use_mana_gem NightFae_Koraylon 13862.5/63371: 22% mana arcane_charge
2:24.177 aoe o arcane_explosion Fluffy_Pillow 20199.6/63371: 32% mana arcane_charge
2:25.482 aoe o arcane_explosion Fluffy_Pillow 16853.6/63371: 27% mana arcane_charge(2)
2:26.788 aoe o arcane_explosion Fluffy_Pillow 13508.9/63371: 21% mana arcane_charge(3)
2:28.094 aoe p arcane_barrage Fluffy_Pillow 10164.1/63371: 16% mana arcane_charge(4)
2:29.403 aoe j touch_of_the_magi Fluffy_Pillow 14358.1/63371: 23% mana
2:30.710 aoe l rune_of_power Fluffy_Pillow 13514.6/63371: 21% mana arcane_charge(4)
2:32.016 aoe p arcane_barrage Fluffy_Pillow 15169.8/63371: 24% mana arcane_charge(4), rune_of_power
2:33.321 aoe o arcane_explosion Fluffy_Pillow 19358.7/63371: 31% mana rune_of_power
2:34.628 aoe o arcane_explosion Fluffy_Pillow 16015.2/63371: 25% mana arcane_charge, rune_of_power
2:35.934 aoe o arcane_explosion Fluffy_Pillow 12670.5/63371: 20% mana arcane_charge(2), clearcasting, rune_of_power
2:37.243 aoe o arcane_explosion Fluffy_Pillow 14329.5/63371: 23% mana arcane_charge(3), rune_of_power
2:38.548 aoe p arcane_barrage Fluffy_Pillow 10983.5/63371: 17% mana arcane_charge(4), rune_of_power
2:39.855 aoe m arcane_orb Fluffy_Pillow 15174.9/63371: 24% mana rune_of_power
2:41.163 aoe p arcane_barrage Fluffy_Pillow 16332.7/63371: 26% mana arcane_charge(4), clearcasting, rune_of_power
2:42.470 aoe o arcane_explosion Fluffy_Pillow 20524.1/63371: 32% mana clearcasting, rune_of_power
2:43.777 aoe o arcane_explosion Fluffy_Pillow 22180.6/63371: 35% mana arcane_charge, rune_of_power
2:45.083 aoe o arcane_explosion Fluffy_Pillow 18835.9/63371: 30% mana arcane_charge(2), clearcasting
2:46.391 aoe o arcane_explosion Fluffy_Pillow 20493.7/63371: 32% mana arcane_charge(3)
2:47.698 aoe p arcane_barrage Fluffy_Pillow 17150.2/63371: 27% mana arcane_charge(4)
2:49.007 aoe o arcane_explosion Fluffy_Pillow 21344.1/63371: 34% mana
2:50.312 aoe o arcane_explosion Fluffy_Pillow 17998.1/63371: 28% mana arcane_charge, clearcasting
2:51.617 aoe o arcane_explosion Fluffy_Pillow 19652.1/63371: 31% mana arcane_charge(2)
2:52.924 aoe o arcane_explosion Fluffy_Pillow 16308.7/63371: 26% mana arcane_charge(3)
2:54.229 aoe n shifting_power Fluffy_Pillow 12962.7/63371: 20% mana arcane_charge(4)
2:58.026 aoe p arcane_barrage Fluffy_Pillow 15275.1/63371: 24% mana arcane_charge(4), clearcasting
2:59.333 aoe m arcane_orb Fluffy_Pillow 19466.5/63371: 31% mana clearcasting
3:00.638 aoe p arcane_barrage Fluffy_Pillow 20620.5/63371: 33% mana arcane_charge(4), clearcasting
3:01.944 aoe o arcane_explosion Fluffy_Pillow 24810.6/63371: 39% mana clearcasting
3:03.249 aoe o arcane_explosion Fluffy_Pillow 26464.6/63371: 42% mana arcane_charge
3:04.555 aoe o arcane_explosion Fluffy_Pillow 23119.8/63371: 36% mana arcane_charge(2)
3:05.862 aoe o arcane_explosion Fluffy_Pillow 19776.4/63371: 31% mana arcane_charge(3)
3:07.168 aoe p arcane_barrage Fluffy_Pillow 16431.6/63371: 26% mana arcane_charge(4)
3:08.472 aoe o arcane_explosion Fluffy_Pillow 20619.2/63371: 33% mana
3:09.779 aoe o arcane_explosion Fluffy_Pillow 17275.7/63371: 27% mana arcane_charge, clearcasting
3:11.085 aoe o arcane_explosion Fluffy_Pillow 18931.0/63371: 30% mana arcane_charge(2)
3:12.390 aoe o arcane_explosion Fluffy_Pillow 15585.0/63371: 25% mana arcane_charge(3), clearcasting
3:13.697 aoe p arcane_barrage Fluffy_Pillow 17241.5/63371: 27% mana arcane_charge(4)
3:15.003 aoe j touch_of_the_magi Fluffy_Pillow 21431.7/63371: 34% mana
3:16.309 aoe k arcane_power Fluffy_Pillow 20586.9/63371: 32% mana arcane_charge(4)
3:16.309 shared_cds t berserking Fluffy_Pillow 20586.9/63371: 32% mana arcane_charge(4), arcane_power, rune_of_power
3:16.309 aoe p arcane_barrage Fluffy_Pillow 20586.9/63371: 32% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:17.495 aoe o arcane_explosion Fluffy_Pillow 24624.9/63371: 39% mana berserking, arcane_power, rune_of_power
3:18.684 aoe o arcane_explosion Fluffy_Pillow 23631.9/63371: 37% mana berserking, arcane_charge, arcane_power, rune_of_power
3:19.873 aoe o arcane_explosion Fluffy_Pillow 22638.9/63371: 36% mana berserking, arcane_charge(2), arcane_power, clearcasting, rune_of_power
3:21.062 aoe o arcane_explosion Fluffy_Pillow 24145.9/63371: 38% mana berserking, arcane_charge(3), arcane_power, rune_of_power
3:22.251 aoe p arcane_barrage Fluffy_Pillow 23152.8/63371: 37% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:23.439 aoe m arcane_orb Fluffy_Pillow 27193.4/63371: 43% mana berserking, arcane_power, rune_of_power
3:24.629 aoe p arcane_barrage Fluffy_Pillow 28451.6/63371: 45% mana berserking, arcane_charge(4), arcane_power, rune_of_power
3:25.818 aoe o arcane_explosion Fluffy_Pillow 32493.5/63371: 51% mana berserking, arcane_power, rune_of_power
3:27.005 aoe o arcane_explosion Fluffy_Pillow 31497.9/63371: 50% mana berserking, arcane_charge, arcane_power, rune_of_power
3:28.193 aoe o arcane_explosion Fluffy_Pillow 30503.6/63371: 48% mana berserking, arcane_charge(2), arcane_power, clearcasting, rune_of_power
3:29.382 aoe o arcane_explosion Fluffy_Pillow 32010.6/63371: 51% mana arcane_charge(3), arcane_power
3:30.688 aoe l rune_of_power Fluffy_Pillow 31165.8/63371: 49% mana arcane_charge(4), arcane_power
3:31.994 aoe p arcane_barrage Fluffy_Pillow 32821.1/63371: 52% mana arcane_charge(4), rune_of_power
3:33.301 aoe o arcane_explosion Fluffy_Pillow 37012.5/63371: 58% mana rune_of_power
3:34.607 aoe o arcane_explosion Fluffy_Pillow 33667.7/63371: 53% mana arcane_charge, rune_of_power
3:35.913 aoe o arcane_explosion Fluffy_Pillow 30323.0/63371: 48% mana arcane_charge(2), rune_of_power
3:37.220 aoe o arcane_explosion Fluffy_Pillow 26979.5/63371: 43% mana arcane_charge(3), rune_of_power
3:38.526 aoe p arcane_barrage Fluffy_Pillow 23634.8/63371: 37% mana arcane_charge(4), rune_of_power
3:39.832 aoe o arcane_explosion Fluffy_Pillow 27824.9/63371: 44% mana rune_of_power
3:41.138 aoe o arcane_explosion Fluffy_Pillow 24480.2/63371: 39% mana arcane_charge, rune_of_power
3:42.443 aoe o arcane_explosion Fluffy_Pillow 21134.2/63371: 33% mana arcane_charge(2), clearcasting, rune_of_power
3:43.750 aoe o arcane_explosion Fluffy_Pillow 22790.7/63371: 36% mana arcane_charge(3), rune_of_power
3:45.057 aoe n shifting_power Fluffy_Pillow 19447.2/63371: 31% mana arcane_charge(4)
3:48.819 aoe p arcane_barrage Fluffy_Pillow 21715.3/63371: 34% mana arcane_charge(4)
3:50.127 aoe m arcane_orb Fluffy_Pillow 25908.0/63371: 41% mana
3:51.433 aoe p arcane_barrage Fluffy_Pillow 27063.2/63371: 43% mana arcane_charge(4)
3:52.739 aoe o arcane_explosion Fluffy_Pillow 31253.3/63371: 49% mana
3:54.044 aoe o arcane_explosion Fluffy_Pillow 27907.3/63371: 44% mana arcane_charge
3:55.350 aoe o arcane_explosion Fluffy_Pillow 24562.6/63371: 39% mana arcane_charge(2)
3:56.656 aoe o arcane_explosion Fluffy_Pillow 21217.9/63371: 33% mana arcane_charge(3)
3:57.963 aoe p arcane_barrage Fluffy_Pillow 17874.4/63371: 28% mana arcane_charge(4)
3:59.270 aoe o arcane_explosion Fluffy_Pillow 22065.8/63371: 35% mana
4:00.576 aoe o arcane_explosion Fluffy_Pillow 18721.0/63371: 30% mana arcane_charge
4:01.882 aoe o arcane_explosion Fluffy_Pillow 15376.3/63371: 24% mana arcane_charge(2)
4:03.188 aoe o arcane_explosion Fluffy_Pillow 12031.6/63371: 19% mana arcane_charge(3), clearcasting
4:04.494 aoe p arcane_barrage Fluffy_Pillow 13686.8/63371: 22% mana arcane_charge(4)
4:05.801 aoe j touch_of_the_magi Fluffy_Pillow 17878.2/63371: 28% mana
4:07.108 aoe l rune_of_power Fluffy_Pillow 17034.7/63371: 27% mana arcane_charge(4)
4:08.414 aoe p arcane_barrage Fluffy_Pillow 18690.0/63371: 29% mana arcane_charge(4), rune_of_power
4:09.719 aoe o arcane_explosion Fluffy_Pillow 22878.8/63371: 36% mana rune_of_power
4:11.024 aoe o arcane_explosion Fluffy_Pillow 19532.8/63371: 31% mana arcane_charge, rune_of_power
4:12.330 aoe o arcane_explosion Fluffy_Pillow 16188.1/63371: 26% mana arcane_charge(2), rune_of_power
4:13.637 aoe o arcane_explosion Fluffy_Pillow 12844.6/63371: 20% mana arcane_charge(3), clearcasting, rune_of_power
4:14.942 aoe p arcane_barrage Fluffy_Pillow 14498.6/63371: 23% mana arcane_charge(4), rune_of_power
4:16.248 aoe m arcane_orb Fluffy_Pillow 18688.7/63371: 29% mana rune_of_power
4:17.554 aoe p arcane_barrage Fluffy_Pillow 19844.0/63371: 31% mana arcane_charge(4), rune_of_power
4:18.859 aoe o arcane_explosion Fluffy_Pillow 24032.9/63371: 38% mana rune_of_power
4:20.165 aoe o arcane_explosion Fluffy_Pillow 20688.1/63371: 33% mana arcane_charge, rune_of_power
4:21.470 aoe o arcane_explosion Fluffy_Pillow 17342.1/63371: 27% mana arcane_charge(2)
4:22.775 aoe o arcane_explosion Fluffy_Pillow 13996.1/63371: 22% mana arcane_charge(3)
4:24.081 shared_cds r use_mana_gem NightFae_Koraylon 10651.4/63371: 17% mana arcane_charge(4), clearcasting
4:24.177 aoe p arcane_barrage Fluffy_Pillow 17110.2/63371: 27% mana arcane_charge(4), clearcasting
4:25.483 aoe o arcane_explosion Fluffy_Pillow 21300.3/63371: 34% mana clearcasting
4:26.790 aoe o arcane_explosion Fluffy_Pillow 22956.8/63371: 36% mana arcane_charge
4:28.096 aoe o arcane_explosion Fluffy_Pillow 19612.1/63371: 31% mana arcane_charge(2)
4:29.401 aoe o arcane_explosion Fluffy_Pillow 16266.1/63371: 26% mana arcane_charge(3)
4:30.708 aoe n shifting_power Fluffy_Pillow 12922.6/63371: 20% mana arcane_charge(4), clearcasting
4:34.363 aoe p arcane_barrage Fluffy_Pillow 15055.1/63371: 24% mana arcane_charge(4), clearcasting
4:35.671 aoe m arcane_orb Fluffy_Pillow 19247.7/63371: 30% mana clearcasting
4:36.976 aoe p arcane_barrage Fluffy_Pillow 20401.7/63371: 32% mana arcane_charge(4), clearcasting
4:38.280 aoe o arcane_explosion Fluffy_Pillow 24589.3/63371: 39% mana clearcasting
4:39.587 aoe o arcane_explosion Fluffy_Pillow 26245.8/63371: 41% mana arcane_charge
4:40.893 aoe o arcane_explosion Fluffy_Pillow 22901.1/63371: 36% mana arcane_charge(2)
4:42.201 aoe o arcane_explosion Fluffy_Pillow 19558.9/63371: 31% mana arcane_charge(3), clearcasting

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="NightFae_Koraylon"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=night_fae
soulbind=325066//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

NightFae_Niya : 17224 dps, 4686 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
17224.4 17224.4 20.2 / 0.117% 1276.9 / 7.4% 9.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
1897.7 1807.7 Mana 0.00% 48.0 100.0% 100%
Talents
Night Fae

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
NightFae_Niya 17224
Arcane Barrage 5729 33.3% 54.6 5.52sec 31509 25444 Direct 272.7 5310 10533 6314 19.2%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 54.61 272.72 0.00 0.00 1.2384 0.0000 1720860.94 1720860.94 0.00% 25444.10 25444.10
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.79% 220.33 166 276 5309.95 2082 26100 5308.54 4791 5701 1169517 1169517 0.00%
crit 19.21% 52.39 28 80 10533.20 4164 52376 10534.90 7730 13893 551344 551344 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:54.62
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 473 2.7% 41.2 6.95sec 3444 0 Direct 206.1 579 1156 689 19.1%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 41.23 206.15 0.00 0.00 0.0000 0.0000 141989.86 141989.86 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.93% 166.83 122 214 578.82 443 664 578.69 560 598 96546 96546 0.00%
crit 19.07% 39.32 21 60 1155.78 886 1329 1156.01 1054 1258 45444 45444 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 7631 44.3% 143.2 2.07sec 16011 12863 Direct 716.0 2685 5365 3202 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 143.19 715.97 0.00 0.00 1.2447 0.0000 2292642.28 2292642.28 0.00% 12863.46 12863.46
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 577.72 457 714 2684.50 1958 4400 2684.70 2589 2741 1550952 1550952 0.00%
crit 19.31% 138.25 87 195 5364.99 3916 8800 5364.10 4980 5812 741690 741690 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:143.19
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1482) 0.0% (8.6%) 13.4 23.00sec 33147 27085

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.42 0.00 0.00 0.00 1.2238 0.0000 0.00 0.00 0.00% 27084.85 27084.85

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.42
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1482 8.6% 67.0 23.00sec 6641 0 Direct 67.0 5558 11120 6643 19.5%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 67.00 67.00 0.00 0.00 0.0000 0.0000 444977.00 444977.00 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.55% 53.97 36 72 5558.20 3869 8695 5561.62 5215 5937 300122 300122 0.00%
crit 19.45% 13.03 5 26 11120.08 7739 17390 11112.44 8568 14000 144855 144855 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (85) 0.0% (0.5%) 18.8 9.17sec 1384 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.79 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 85 0.5% 18.8 9.17sec 1384 0 Direct 18.8 1164 2327 1384 19.0%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 18.79 18.79 0.00 0.00 0.0000 0.0000 26004.58 26004.58 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.04% 15.23 6 28 1163.53 1164 1164 1163.53 1164 1164 17716 17716 0.00%
crit 18.96% 3.56 0 14 2327.06 2327 2327 2249.34 0 2327 8289 8289 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1744 17.9%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1745.40 1745.40 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 82.12% 0.82 0 1 1480.68 1481 1481 1215.96 0 1481 1216 1216 0.00%
crit 17.88% 0.18 0 1 2961.35 2961 2961 529.44 0 2961 529 529 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (19) 0.0% (0.1%) 1.0 0.00sec 5780 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 145  / 19 0.1% 90.0 1.29sec 64 49 Direct 90.0 54 108 64 19.1%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5780.16 5780.16 0.00% 49.08 49.08
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.89% 72.80 62 83 53.94 43 60 53.94 53 55 3927 3927 0.00%
crit 19.11% 17.20 7 28 107.77 86 120 107.74 92 118 1853 1853 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Shifting Power 658 3.8% 6.1 48.40sec 32537 9113 Periodic 120.7 1372 2745 1638 19.3% 1.3%

Stats Details: Shifting Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.08 0.00 24.15 120.74 3.5704 0.8349 197749.61 197749.61 0.00% 9113.31 9113.31
Tick Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Total Mitigated
hit 80.65% 97.38 68 126 1372.31 1372 1372 1372.31 1372 1372 133639 133639 0.00%
crit 19.35% 23.36 7 41 2744.61 2745 2745 2744.61 2745 2745 64110 64110 0.00%

Action Details: Shifting Power

  • id:314791
  • school:nature
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:314791
  • name:Shifting Power
  • school:nature
  • tooltip:Every $t1 sec, deal {$325130s1=0} Nature damage to enemies within $325130A1 yds and reduce the remaining cooldown of your abilities by ${-{$s2=3000}/1000} sec.
  • description:Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.

Action Details: Shifting Power Pulse

  • id:325130
  • school:nature
  • range:100.0
  • travel_speed:0.0000
  • radius:18.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.473600
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:325130
  • name:Shifting Power
  • school:nature
  • tooltip:
  • description:{$@spelldesc314791=Draw power from the ground beneath, dealing ${{$325130s1=0}*{$d=4 seconds}/$t} Nature damage over {$d=4 seconds} to enemies within $325130A1 yds. While channeling, your Mage ability cooldowns are reduced by ${-{$s2=3000}/1000*{$d=4 seconds}/$t} sec over {$d=4 seconds}.}

Action Priority List

    aoe
    [n]:6.08
  • if_expr:buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
Touch of the Magi 0 (1142) 0.0% (6.6%) 6.6 48.80sec 51570 39473

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.64 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 39472.94 39472.94

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.68
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 1142 6.6% 6.6 48.63sec 51570 0 Direct 33.0 10385 0 10385 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.64 33.02 0.00 0.00 0.0000 0.0000 342348.82 342348.82 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 33.02 25 40 10385.18 2669 49472 10396.56 8646 13563 342349 342349 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11612.70
  • base_dd_max:11612.70
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
NightFae_Niya
Arcane Power 3.6 97.12sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 3.57 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:3.58
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 2.0 194.65sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:2.00
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.0 0.00sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.05 0.00 0.27 0.00 4.1814 0.7187 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.05
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.5 300.38sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.49
  • if_expr:buff.arcane_power.up
Rune of Power 6.5 47.08sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.49 0.00 0.00 0.00 1.2603 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.51
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.8 120.65sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.80 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:NightFae_Niya
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.81
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 55.4 174.9 5.4sec 1.3sec 4.1sec 75.50% 0.00% 28.7 (29.8) 0.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 14.7s
  • trigger_min/max:0.0s / 9.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 13.4s

Stack Uptimes

  • arcane_charge_1:18.02%
  • arcane_charge_2:15.45%
  • arcane_charge_3:14.49%
  • arcane_charge_4:27.54%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 3.6 0.0 97.1sec 97.1sec 14.7sec 17.49% 0.00% 0.0 (0.0) 3.5

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:96.0s / 102.0s
  • trigger_min/max:96.0s / 102.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:17.49%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 2.0 0.0 194.7sec 194.7sec 12.0sec 8.09% 23.62% 0.0 (0.0) 2.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:193.2s / 199.3s
  • trigger_min/max:193.2s / 199.3s
  • trigger_pct:100.00%
  • duration_min/max:12.0s / 12.0s

Stack Uptimes

  • berserking_1:8.09%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 22.5 0.3 13.0sec 12.8sec 2.2sec 16.77% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.42%
  • clearcasting_2:0.38%
  • clearcasting_3:0.05%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.0 0.0 0.0sec 0.0sec 4.2sec 0.07% 0.00% 0.2 (0.2) 0.0

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:2.8s / 4.3s

Stack Uptimes

  • evocation_1:0.11%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.5 0.0 300.4sec 300.4sec 23.3sec 11.37% 0.00% 0.0 (0.0) 1.3

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:300.0s / 301.0s
  • trigger_min/max:300.0s / 301.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:11.37%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Redirected Anima 16.9 0.0 53.1sec 16.7sec 67.7sec 84.60% 0.00% 0.0 (0.0) 2.8

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_redirected_anima
  • max_stacks:50
  • base duration:30.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:25.00

Trigger Details

  • interval_min/max:0.5s / 325.4s
  • trigger_min/max:0.3s / 54.7s
  • trigger_pct:98.35%
  • duration_min/max:0.0s / 341.7s

Stack Uptimes

  • redirected_anima_1:16.10%
  • redirected_anima_2:7.82%
  • redirected_anima_3:2.38%
  • redirected_anima_4:0.52%
  • redirected_anima_5:0.07%
  • redirected_anima_6:16.65%
  • redirected_anima_7:23.76%
  • redirected_anima_8:12.29%
  • redirected_anima_9:3.98%
  • redirected_anima_10:0.87%
  • redirected_anima_11:0.17%
  • redirected_anima_12:0.05%
  • redirected_anima_13:0.00%

Spelldata

  • id:342814
  • name:Redirected Anima
  • tooltip:Max health increased by $w1%. Mastery increased by $w2.
  • description:{$@spelldesc322721=Healing or dealing damage has a chance to grant you a stack of Redirected Anima. Redirected Anima increases your maximum health by {$342814s1=1}% and your Mastery by {$342814s2=25} for {$342814d=30 seconds}, and stacks overlap. $?(s152280&a137005)[Defile]?(a137005&!s152280)[Death's Due]?a212611[The Hunt]?a137009[Convoke the Spirits]?a137014[Wild Spirits]?a137018[Shifting Power]?a137022[Faeline Stomp]?a137026[Blessing of Seasons]?a137030[Fae Guardians]?a137034[Sepsis]?a137038[Fae Transfusion]?a137042[Soul Rot]?a137047[Ancient Aftershock][Activating your Night Fae class ability] grants you ${{$s3=8}*$<mod>} stacks of Redirected Anima.}
  • max_stacks:50
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 10.1 0.0 31.1sec 31.1sec 11.8sec 39.34% 0.00% 0.0 (0.0) 9.7

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:14.4s / 48.7s
  • trigger_min/max:14.4s / 48.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • rune_of_power_1:39.34%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 1.64% 0.76% 5.77% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 300.7s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000204.660144.091263.937
Evocation247.598170.770288.783298.558185.450359.937
Rune of Power13.4780.01431.41890.76172.307108.822
Touch of the Magi12.2200.00020.94584.22668.056106.163
Arcane Power1.1890.0056.0124.2512.6838.938
Arcane Barrage3.0160.00312.086165.997132.680199.441
Arcane Orb4.2690.00011.03557.95638.96872.980
Shifting Power7.8280.00030.23147.78343.43156.989

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
NightFae_Niya
mana_regen Mana 716.46 384796.12 70.80% 537.08 7368.44 1.88%
Evocation Mana 2.18 2242.94 0.41% 1028.93 0.00 0.00%
Mana Gem Mana 2.81 18162.44 3.34% 6471.39 0.00 0.00%
Arcane Barrage Mana 54.62 138307.43 25.45% 2532.13 4658.26 3.26%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1807.70 1897.72 12029.3 34821.6 2852.9 63371.4
Usage Type Count Total Avg RPE APR
NightFae_Niya
arcane_explosion Mana 143.2 531820.6 3714.1 3714.0 4.3
arcane_orb Mana 13.4 5834.9 434.9 434.6 76.3
shifting_power Mana 6.1 15191.0 2500.0 2499.5 13.0
touch_of_the_magi Mana 6.6 16610.3 2500.0 2502.1 20.6

Statistics & Data Analysis

Fight Length
NightFae_Niya Fight Length
Count 1018
Mean 300.66
Minimum 240.09
Maximum 359.94
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
NightFae_Niya Damage Per Second
Count 1018
Mean 17224.37
Minimum 16407.14
Maximum 18560.52
Spread ( max - min ) 2153.38
Range [ ( max - min ) / 2 * 100% ] 6.25%
Standard Deviation 328.2489
5th Percentile 16711.27
95th Percentile 17765.07
( 95th Percentile - 5th Percentile ) 1053.80
Mean Distribution
Standard Deviation 10.2880
95.00% Confidence Interval ( 17204.21 - 17244.53 )
Normalized 95.00% Confidence Interval ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 14
0.1% Error 1396
0.1 Scale Factor Error with Delta=300 920
0.05 Scale Factor Error with Delta=300 3680
0.01 Scale Factor Error with Delta=300 91980
Priority Target DPS
NightFae_Niya Priority Target Damage Per Second
Count 1018
Mean 4686.19
Minimum 4230.85
Maximum 5356.74
Spread ( max - min ) 1125.89
Range [ ( max - min ) / 2 * 100% ] 12.01%
Standard Deviation 162.5093
5th Percentile 4440.01
95th Percentile 4953.16
( 95th Percentile - 5th Percentile ) 513.16
Mean Distribution
Standard Deviation 5.0934
95.00% Confidence Interval ( 4676.21 - 4696.18 )
Normalized 95.00% Confidence Interval ( 99.79% - 100.21% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4620
0.1 Scale Factor Error with Delta=300 226
0.05 Scale Factor Error with Delta=300 902
0.01 Scale Factor Error with Delta=300 22545
DPS(e)
NightFae_Niya Damage Per Second (Effective)
Count 1018
Mean 17224.37
Minimum 16407.14
Maximum 18560.52
Spread ( max - min ) 2153.38
Range [ ( max - min ) / 2 * 100% ] 6.25%
Damage
NightFae_Niya Damage
Count 1018
Mean 5168318.49
Minimum 4136536.86
Maximum 6255695.46
Spread ( max - min ) 2119158.60
Range [ ( max - min ) / 2 * 100% ] 20.50%
DTPS
NightFae_Niya Damage Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
NightFae_Niya Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
NightFae_Niya Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
NightFae_Niya Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
NightFae_Niya Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
NightFae_Niya Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
NightFae_NiyaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
NightFae_Niya Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.68 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 3.58 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.51 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.42 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
n 6.08 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 143.19 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 54.62 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.05 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.81 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.49 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 2.00 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABDGHILMNPQRVXYjkstpmpoooopoooopoooolpooroopmpoooonpmpoooopoooopoojlpmpoooopoooopoooonpmpoooopoooopojkpoooopmpoooolpoooopoooonpmpoooopoooorpjlpoooopmpoooopoooonpmpoooopoooopjktpoooopmpoooolpoooopoooonpmpoooopoooopjlpoooopmpoooopoooronpmpoooop

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat D totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat H barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask NightFae_Niya 63371.4/63371: 100% mana
Pre precombat R food NightFae_Niya 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana
0:01.305 aoe k arcane_power Fluffy_Pillow 60875.2/63371: 96% mana bloodlust, arcane_charge(4)
0:01.305 shared_cds s potion Fluffy_Pillow 60875.2/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:01.305 shared_cds t berserking Fluffy_Pillow 60875.2/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:01.305 aoe p arcane_barrage Fluffy_Pillow 60875.2/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.218 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.133 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.048 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.963 aoe o arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.878 aoe o arcane_explosion Fluffy_Pillow 60690.8/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:06.793 aoe o arcane_explosion Fluffy_Pillow 59350.5/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.707 aoe p arcane_barrage Fluffy_Pillow 58008.9/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.621 aoe o arcane_explosion Fluffy_Pillow 61702.2/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.536 aoe o arcane_explosion Fluffy_Pillow 60361.9/63371: 95% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.450 aoe o arcane_explosion Fluffy_Pillow 59020.4/63371: 93% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.363 aoe o arcane_explosion Fluffy_Pillow 57677.5/63371: 91% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.277 aoe p arcane_barrage Fluffy_Pillow 56336.0/63371: 89% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.193 aoe o arcane_explosion Fluffy_Pillow 60031.8/63371: 95% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.107 aoe o arcane_explosion Fluffy_Pillow 58690.2/63371: 93% mana bloodlust, arcane_charge, arcane_power, potion_of_deathly_fixation
0:15.114 aoe o arcane_explosion Fluffy_Pillow 57466.5/63371: 91% mana bloodlust, arcane_charge(2), arcane_power, potion_of_deathly_fixation
0:16.120 aoe o arcane_explosion Fluffy_Pillow 56241.5/63371: 89% mana bloodlust, arcane_charge(3), arcane_power, potion_of_deathly_fixation
0:17.127 aoe l rune_of_power Fluffy_Pillow 55017.8/63371: 87% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:18.132 aoe p arcane_barrage Fluffy_Pillow 56291.6/63371: 89% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:19.139 aoe o arcane_explosion Fluffy_Pillow 60102.8/63371: 95% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:20.145 aoe o arcane_explosion Fluffy_Pillow 56377.8/63371: 89% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:21.151 shared_cds r use_mana_gem NightFae_Niya 52652.8/63371: 83% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:21.151 aoe o arcane_explosion Fluffy_Pillow 58990.0/63371: 93% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:22.157 aoe o arcane_explosion Fluffy_Pillow 55265.0/63371: 87% mana bloodlust, arcane_charge(3), clearcasting, rune_of_power, potion_of_deathly_fixation
0:23.164 aoe p arcane_barrage Fluffy_Pillow 56541.3/63371: 89% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:24.170 aoe m arcane_orb Fluffy_Pillow 60351.2/63371: 95% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:25.176 aoe p arcane_barrage Fluffy_Pillow 61126.2/63371: 96% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:26.182 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:27.189 aoe o arcane_explosion Fluffy_Pillow 59647.7/63371: 94% mana bloodlust, arcane_charge, rune_of_power
0:28.197 aoe o arcane_explosion Fluffy_Pillow 55925.3/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power
0:29.203 aoe o arcane_explosion Fluffy_Pillow 52200.3/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power
0:30.209 aoe n shifting_power Fluffy_Pillow 48475.4/63371: 76% mana bloodlust, arcane_charge(4)
0:33.211 aoe p arcane_barrage Fluffy_Pillow 51800.1/65943: 79% mana bloodlust, arcane_charge(4), redirected_anima(6)
0:34.218 aoe m arcane_orb Fluffy_Pillow 55765.9/65943: 85% mana bloodlust, redirected_anima(6)
0:35.226 aoe p arcane_barrage Fluffy_Pillow 56595.3/65943: 86% mana bloodlust, arcane_charge(4), redirected_anima(6)
0:36.232 aoe o arcane_explosion Fluffy_Pillow 60559.8/65943: 92% mana bloodlust, redirected_anima(6)
0:37.238 aoe o arcane_explosion Fluffy_Pillow 56886.6/65943: 86% mana bloodlust, arcane_charge, redirected_anima(6)
0:38.246 aoe o arcane_explosion Fluffy_Pillow 53216.0/65943: 81% mana bloodlust, arcane_charge(2), clearcasting, redirected_anima(6)
0:39.251 aoe o arcane_explosion Fluffy_Pillow 54541.4/65943: 83% mana bloodlust, arcane_charge(3), redirected_anima(6)
0:40.259 aoe p arcane_barrage Fluffy_Pillow 50870.9/65943: 77% mana bloodlust, arcane_charge(4), redirected_anima(6)
0:41.266 aoe o arcane_explosion Fluffy_Pillow 54836.7/65943: 83% mana redirected_anima(6)
0:42.572 aoe o arcane_explosion Fluffy_Pillow 51559.1/65943: 78% mana arcane_charge, redirected_anima(6)
0:43.879 aoe o arcane_explosion Fluffy_Pillow 48282.8/65943: 73% mana arcane_charge(2), clearcasting, redirected_anima(6)
0:45.186 aoe o arcane_explosion Fluffy_Pillow 50006.6/65943: 76% mana arcane_charge(3), redirected_anima(6)
0:46.494 aoe p arcane_barrage Fluffy_Pillow 46731.6/65943: 71% mana arcane_charge(4), clearcasting, redirected_anima(6)
0:47.802 aoe o arcane_explosion Fluffy_Pillow 51094.4/65943: 77% mana clearcasting, redirected_anima(6)
0:49.108 aoe o arcane_explosion Fluffy_Pillow 52816.8/65943: 80% mana arcane_charge, redirected_anima(6)
0:50.415 aoe j touch_of_the_magi Fluffy_Pillow 49540.6/65943: 75% mana arcane_charge(2), redirected_anima(6)
0:51.721 aoe l rune_of_power Fluffy_Pillow 48763.0/65943: 74% mana arcane_charge(4), redirected_anima(6)
0:53.026 aoe p arcane_barrage Fluffy_Pillow 50484.1/65943: 77% mana arcane_charge(4), rune_of_power, redirected_anima(6)
0:54.331 aoe m arcane_orb Fluffy_Pillow 54843.0/65943: 83% mana rune_of_power, redirected_anima(6)
0:55.638 aoe p arcane_barrage Fluffy_Pillow 56066.7/65943: 85% mana arcane_charge(4), rune_of_power, redirected_anima(6)
0:56.945 aoe o arcane_explosion Fluffy_Pillow 60428.2/65943: 92% mana rune_of_power, redirected_anima(6)
0:58.251 aoe o arcane_explosion Fluffy_Pillow 57150.6/65943: 87% mana arcane_charge, rune_of_power, redirected_anima(6)
0:59.556 aoe o arcane_explosion Fluffy_Pillow 53871.7/65943: 82% mana arcane_charge(2), clearcasting, rune_of_power, redirected_anima(6)
1:00.863 aoe o arcane_explosion Fluffy_Pillow 53427.5/63371: 84% mana arcane_charge(3), rune_of_power
1:02.170 aoe p arcane_barrage Fluffy_Pillow 50084.0/63371: 79% mana arcane_charge(4), clearcasting, rune_of_power
1:03.477 aoe o arcane_explosion Fluffy_Pillow 54275.4/63371: 86% mana clearcasting, rune_of_power
1:04.783 aoe o arcane_explosion Fluffy_Pillow 56308.9/63800: 88% mana arcane_charge, rune_of_power, redirected_anima
1:06.089 aoe o arcane_explosion Fluffy_Pillow 53331.3/64229: 83% mana arcane_charge(2), redirected_anima(2)
1:07.395 aoe o arcane_explosion Fluffy_Pillow 50008.9/64229: 78% mana arcane_charge(3), clearcasting, redirected_anima(2)
1:08.701 aoe p arcane_barrage Fluffy_Pillow 51686.6/64229: 80% mana arcane_charge(4), redirected_anima(2)
1:10.007 aoe o arcane_explosion Fluffy_Pillow 55933.3/64229: 87% mana redirected_anima(2)
1:11.314 aoe o arcane_explosion Fluffy_Pillow 52612.3/64229: 82% mana arcane_charge, redirected_anima(2)
1:12.622 aoe o arcane_explosion Fluffy_Pillow 49292.5/64229: 77% mana arcane_charge(2), clearcasting, redirected_anima(2)
1:13.928 aoe o arcane_explosion Fluffy_Pillow 50970.1/64229: 79% mana arcane_charge(3), redirected_anima(2)
1:15.235 aoe n shifting_power Fluffy_Pillow 47649.1/64229: 74% mana arcane_charge(4), redirected_anima(2)
1:19.023 aoe p arcane_barrage Fluffy_Pillow 52017.4/66800: 78% mana arcane_charge(4), clearcasting, redirected_anima(8)
1:20.329 aoe m arcane_orb Fluffy_Pillow 56434.2/66800: 84% mana clearcasting, redirected_anima(8)
1:21.636 aoe p arcane_barrage Fluffy_Pillow 57680.4/66800: 86% mana arcane_charge(4), clearcasting, redirected_anima(8)
1:22.941 aoe o arcane_explosion Fluffy_Pillow 62095.9/66800: 93% mana clearcasting, redirected_anima(8)
1:24.248 aoe o arcane_explosion Fluffy_Pillow 64251.6/67229: 96% mana arcane_charge, redirected_anima(9)
1:25.553 aoe o arcane_explosion Fluffy_Pillow 61395.2/67657: 91% mana arcane_charge(2), redirected_anima(10)
1:26.859 aoe o arcane_explosion Fluffy_Pillow 58162.4/67657: 86% mana arcane_charge(3), clearcasting, redirected_anima(10)
1:28.166 aoe p arcane_barrage Fluffy_Pillow 59930.9/67657: 89% mana arcane_charge(4), redirected_anima(10)
1:29.472 aoe o arcane_explosion Fluffy_Pillow 64404.4/67657: 95% mana redirected_anima(10)
1:30.777 aoe o arcane_explosion Fluffy_Pillow 61170.3/67657: 90% mana arcane_charge, redirected_anima(10)
1:32.083 aoe o arcane_explosion Fluffy_Pillow 57937.5/67657: 86% mana arcane_charge(2), redirected_anima(10)
1:33.389 aoe o arcane_explosion Fluffy_Pillow 54704.7/67657: 81% mana arcane_charge(3), redirected_anima(10)
1:34.696 aoe p arcane_barrage Fluffy_Pillow 51147.2/67229: 76% mana arcane_charge(4), redirected_anima(9)
1:36.001 aoe o arcane_explosion Fluffy_Pillow 55236.6/66800: 83% mana redirected_anima(8)
1:37.306 aoe j touch_of_the_magi Fluffy_Pillow 51980.1/66800: 78% mana arcane_charge, redirected_anima(8)
1:38.613 aoe k arcane_power Fluffy_Pillow 51226.3/66800: 77% mana arcane_charge(4), redirected_anima(8)
1:38.613 aoe p arcane_barrage Fluffy_Pillow 51226.3/66800: 77% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(8)
1:39.920 aoe o arcane_explosion Fluffy_Pillow 55644.4/66800: 83% mana arcane_power, rune_of_power, redirected_anima(8)
1:41.229 aoe o arcane_explosion Fluffy_Pillow 55245.4/67229: 82% mana arcane_charge, arcane_power, rune_of_power, redirected_anima(9)
1:42.535 aoe o arcane_explosion Fluffy_Pillow 54501.4/67229: 81% mana arcane_charge(2), arcane_power, rune_of_power, redirected_anima(9)
1:43.840 aoe o arcane_explosion Fluffy_Pillow 53756.1/67229: 80% mana arcane_charge(3), arcane_power, rune_of_power, redirected_anima(9)
1:45.147 aoe p arcane_barrage Fluffy_Pillow 53013.4/67229: 79% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(9)
1:46.453 aoe m arcane_orb Fluffy_Pillow 55260.9/64657: 85% mana arcane_power, rune_of_power, redirected_anima(3)
1:47.759 aoe p arcane_barrage Fluffy_Pillow 56699.7/64657: 88% mana arcane_charge(4), arcane_power, rune_of_power, redirected_anima(3)
1:49.066 aoe o arcane_explosion Fluffy_Pillow 60976.1/64657: 94% mana arcane_power, rune_of_power, redirected_anima(3)
1:50.373 aoe o arcane_explosion Fluffy_Pillow 60166.3/64657: 93% mana arcane_charge, arcane_power, clearcasting, rune_of_power, redirected_anima(3)
1:51.679 aoe o arcane_explosion Fluffy_Pillow 61855.1/64657: 96% mana arcane_charge(2), arcane_power, redirected_anima(3)
1:52.985 aoe o arcane_explosion Fluffy_Pillow 60639.3/64229: 94% mana arcane_charge(3), arcane_power, redirected_anima(2)
1:54.292 aoe l rune_of_power Fluffy_Pillow 59419.1/63800: 93% mana arcane_charge(4), redirected_anima
1:55.599 aoe p arcane_barrage Fluffy_Pillow 61086.9/63800: 96% mana arcane_charge(4), rune_of_power, redirected_anima
1:56.906 aoe o arcane_explosion Fluffy_Pillow 63800.0/63800: 100% mana rune_of_power, redirected_anima
1:58.212 aoe o arcane_explosion Fluffy_Pillow 60466.5/63800: 95% mana arcane_charge, clearcasting, rune_of_power, redirected_anima
1:59.519 aoe o arcane_explosion Fluffy_Pillow 62134.2/63800: 97% mana arcane_charge(2), rune_of_power, redirected_anima
2:00.826 aoe o arcane_explosion Fluffy_Pillow 58801.9/63800: 92% mana arcane_charge(3), rune_of_power, redirected_anima
2:02.133 aoe p arcane_barrage Fluffy_Pillow 55469.7/63800: 87% mana arcane_charge(4), rune_of_power, redirected_anima
2:03.439 aoe o arcane_explosion Fluffy_Pillow 60089.1/64229: 94% mana rune_of_power, redirected_anima(2)
2:04.744 aoe o arcane_explosion Fluffy_Pillow 56765.4/64229: 88% mana arcane_charge, rune_of_power, redirected_anima(2)
2:06.051 aoe o arcane_explosion Fluffy_Pillow 53444.4/64229: 83% mana arcane_charge(2), clearcasting, rune_of_power, redirected_anima(2)
2:07.356 aoe o arcane_explosion Fluffy_Pillow 55120.7/64229: 86% mana arcane_charge(3), rune_of_power, redirected_anima(2)
2:08.663 aoe n shifting_power Fluffy_Pillow 51799.7/64229: 81% mana arcane_charge(4), redirected_anima(2)
2:12.373 aoe p arcane_barrage Fluffy_Pillow 55869.2/66371: 84% mana arcane_charge(4), redirected_anima(7)
2:13.679 aoe m arcane_orb Fluffy_Pillow 60257.7/66371: 91% mana redirected_anima(7)
2:14.986 aoe p arcane_barrage Fluffy_Pillow 61492.6/66371: 93% mana arcane_charge(4), redirected_anima(7)
2:16.291 aoe o arcane_explosion Fluffy_Pillow 65879.8/66371: 99% mana redirected_anima(7)
2:17.598 aoe o arcane_explosion Fluffy_Pillow 62614.7/66371: 94% mana arcane_charge, clearcasting, redirected_anima(7)
2:18.905 aoe o arcane_explosion Fluffy_Pillow 64349.7/66371: 97% mana arcane_charge(2), redirected_anima(7)
2:20.211 aoe o arcane_explosion Fluffy_Pillow 61083.3/66371: 92% mana arcane_charge(3), redirected_anima(7)
2:21.518 aoe p arcane_barrage Fluffy_Pillow 57818.3/66371: 87% mana arcane_charge(4), redirected_anima(7)
2:22.826 aoe o arcane_explosion Fluffy_Pillow 62209.4/66371: 94% mana redirected_anima(7)
2:24.134 aoe o arcane_explosion Fluffy_Pillow 58945.7/66371: 89% mana arcane_charge, clearcasting, redirected_anima(7)
2:25.439 aoe o arcane_explosion Fluffy_Pillow 60678.0/66371: 91% mana arcane_charge(2), redirected_anima(7)
2:26.746 aoe o arcane_explosion Fluffy_Pillow 57412.9/66371: 87% mana arcane_charge(3), redirected_anima(7)
2:28.052 shared_cds r use_mana_gem NightFae_Niya 54146.5/66371: 82% mana arcane_charge(4), redirected_anima(7)
2:28.052 aoe p arcane_barrage Fluffy_Pillow 60783.7/66371: 92% mana arcane_charge(4), redirected_anima(7)
2:29.358 aoe j touch_of_the_magi Fluffy_Pillow 65172.1/66371: 98% mana redirected_anima(7)
2:30.664 aoe l rune_of_power Fluffy_Pillow 63876.7/66371: 96% mana arcane_charge(4), redirected_anima(7)
2:31.968 aoe p arcane_barrage Fluffy_Pillow 65607.7/66371: 99% mana arcane_charge(4), rune_of_power, redirected_anima(7)
2:33.273 aoe o arcane_explosion Fluffy_Pillow 65942.9/65943: 100% mana rune_of_power, redirected_anima(6)
2:34.580 aoe o arcane_explosion Fluffy_Pillow 62666.6/65943: 95% mana arcane_charge, rune_of_power, redirected_anima(6)
2:35.885 aoe o arcane_explosion Fluffy_Pillow 59387.7/65943: 90% mana arcane_charge(2), rune_of_power, redirected_anima(6)
2:37.191 aoe o arcane_explosion Fluffy_Pillow 56110.1/65943: 85% mana arcane_charge(3), clearcasting, rune_of_power, redirected_anima(6)
2:38.499 aoe p arcane_barrage Fluffy_Pillow 57835.2/65943: 88% mana arcane_charge(4), rune_of_power, redirected_anima(6)
2:39.805 aoe m arcane_orb Fluffy_Pillow 59770.1/63371: 94% mana rune_of_power
2:41.112 aoe p arcane_barrage Fluffy_Pillow 60926.6/63371: 96% mana arcane_charge(4), rune_of_power
2:42.419 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power
2:43.726 aoe o arcane_explosion Fluffy_Pillow 60028.0/63371: 95% mana arcane_charge, rune_of_power
2:45.033 aoe o arcane_explosion Fluffy_Pillow 56684.5/63371: 89% mana arcane_charge(2)
2:46.339 aoe o arcane_explosion Fluffy_Pillow 53339.7/63371: 84% mana arcane_charge(3)
2:47.645 aoe p arcane_barrage Fluffy_Pillow 49995.0/63371: 79% mana arcane_charge(4)
2:48.951 aoe o arcane_explosion Fluffy_Pillow 54185.1/63371: 86% mana
2:50.258 aoe o arcane_explosion Fluffy_Pillow 50841.7/63371: 80% mana arcane_charge
2:51.564 aoe o arcane_explosion Fluffy_Pillow 47496.9/63371: 75% mana arcane_charge(2), clearcasting
2:52.869 aoe o arcane_explosion Fluffy_Pillow 49150.9/63371: 78% mana arcane_charge(3)
2:54.175 aoe n shifting_power Fluffy_Pillow 45806.2/63371: 72% mana arcane_charge(4)
2:57.902 aoe p arcane_barrage Fluffy_Pillow 50303.6/66371: 76% mana arcane_charge(4), redirected_anima(7)
2:59.207 aoe m arcane_orb Fluffy_Pillow 54690.8/66371: 82% mana redirected_anima(7)
3:00.513 aoe p arcane_barrage Fluffy_Pillow 55924.4/66371: 84% mana arcane_charge(4), redirected_anima(7)
3:01.819 aoe o arcane_explosion Fluffy_Pillow 60312.9/66371: 91% mana redirected_anima(7)
3:03.126 aoe o arcane_explosion Fluffy_Pillow 57047.8/66371: 86% mana arcane_charge, redirected_anima(7)
3:04.434 aoe o arcane_explosion Fluffy_Pillow 53784.1/66371: 81% mana arcane_charge(2), clearcasting, redirected_anima(7)
3:05.742 aoe o arcane_explosion Fluffy_Pillow 55520.4/66371: 84% mana arcane_charge(3), redirected_anima(7)
3:07.047 aoe p arcane_barrage Fluffy_Pillow 52252.7/66371: 79% mana arcane_charge(4), redirected_anima(7)
3:08.355 aoe o arcane_explosion Fluffy_Pillow 57009.6/66800: 85% mana redirected_anima(8)
3:09.661 aoe o arcane_explosion Fluffy_Pillow 53754.4/66800: 80% mana arcane_charge, redirected_anima(8)
3:10.968 aoe o arcane_explosion Fluffy_Pillow 50500.5/66800: 76% mana arcane_charge(2), redirected_anima(8)
3:12.276 aoe o arcane_explosion Fluffy_Pillow 47248.0/66800: 71% mana arcane_charge(3), redirected_anima(8)
3:13.582 aoe p arcane_barrage Fluffy_Pillow 43992.8/66800: 66% mana arcane_charge(4), redirected_anima(8)
3:14.887 aoe j touch_of_the_magi Fluffy_Pillow 48408.3/66800: 72% mana redirected_anima(8)
3:16.195 aoe k arcane_power Fluffy_Pillow 47655.8/66800: 71% mana arcane_charge(4), clearcasting, redirected_anima(8)
3:16.195 shared_cds t berserking Fluffy_Pillow 47655.8/66800: 71% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power, redirected_anima(8)
3:16.195 aoe p arcane_barrage Fluffy_Pillow 47655.8/66800: 71% mana berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, redirected_anima(8)
3:17.383 aoe o arcane_explosion Fluffy_Pillow 51915.0/66800: 78% mana berserking, arcane_power, clearcasting, rune_of_power, redirected_anima(8)
3:18.572 aoe o arcane_explosion Fluffy_Pillow 53503.5/66800: 80% mana berserking, arcane_charge, arcane_power, rune_of_power, redirected_anima(8)
3:19.760 aoe o arcane_explosion Fluffy_Pillow 52590.6/66800: 79% mana berserking, arcane_charge(2), arcane_power, rune_of_power, redirected_anima(8)
3:20.946 aoe o arcane_explosion Fluffy_Pillow 51675.1/66800: 77% mana berserking, arcane_charge(3), arcane_power, rune_of_power, redirected_anima(8)
3:22.133 aoe p arcane_barrage Fluffy_Pillow 51086.6/67229: 76% mana berserking, arcane_charge(4), arcane_power, rune_of_power, redirected_anima(9)
3:23.322 aoe m arcane_orb Fluffy_Pillow 55374.5/67229: 82% mana berserking, arcane_power, rune_of_power, redirected_anima(9)
3:24.512 aoe p arcane_barrage Fluffy_Pillow 54554.9/64657: 84% mana berserking, arcane_charge(4), arcane_power, rune_of_power, redirected_anima(3)
3:25.701 aoe o arcane_explosion Fluffy_Pillow 58678.7/64657: 91% mana berserking, arcane_power, rune_of_power, redirected_anima(3)
3:26.889 aoe o arcane_explosion Fluffy_Pillow 57714.9/64657: 89% mana berserking, arcane_charge, arcane_power, rune_of_power, redirected_anima(3)
3:28.077 aoe o arcane_explosion Fluffy_Pillow 56751.2/64657: 88% mana berserking, arcane_charge(2), arcane_power, rune_of_power, redirected_anima(3)
3:29.266 aoe o arcane_explosion Fluffy_Pillow 55788.7/64657: 86% mana arcane_charge(3), arcane_power, redirected_anima(3)
3:30.572 aoe l rune_of_power Fluffy_Pillow 54977.6/64657: 85% mana arcane_charge(4), arcane_power, redirected_anima(3)
3:31.880 aoe p arcane_barrage Fluffy_Pillow 56669.0/64657: 88% mana arcane_charge(4), rune_of_power, redirected_anima(3)
3:33.185 aoe o arcane_explosion Fluffy_Pillow 60942.9/64657: 94% mana rune_of_power, redirected_anima(3)
3:34.492 aoe o arcane_explosion Fluffy_Pillow 57633.0/64657: 89% mana arcane_charge, rune_of_power, redirected_anima(3)
3:35.797 aoe o arcane_explosion Fluffy_Pillow 54320.5/64657: 84% mana arcane_charge(2), rune_of_power, redirected_anima(3)
3:37.104 aoe o arcane_explosion Fluffy_Pillow 50672.6/64229: 79% mana arcane_charge(3), rune_of_power, redirected_anima(2)
3:38.410 aoe p arcane_barrage Fluffy_Pillow 47350.2/64229: 74% mana arcane_charge(4), rune_of_power, redirected_anima(2)
3:39.717 aoe o arcane_explosion Fluffy_Pillow 51598.3/64229: 80% mana rune_of_power, redirected_anima(2)
3:41.024 aoe o arcane_explosion Fluffy_Pillow 48277.2/64229: 75% mana arcane_charge, rune_of_power, redirected_anima(2)
3:42.331 aoe o arcane_explosion Fluffy_Pillow 44956.2/64229: 70% mana arcane_charge(2), clearcasting, rune_of_power, redirected_anima(2)
3:43.637 aoe o arcane_explosion Fluffy_Pillow 46633.8/64229: 73% mana arcane_charge(3), rune_of_power, redirected_anima(2)
3:44.944 aoe n shifting_power Fluffy_Pillow 43312.7/64229: 67% mana arcane_charge(4), redirected_anima(2)
3:48.597 aoe p arcane_barrage Fluffy_Pillow 47327.1/66800: 71% mana arcane_charge(4), redirected_anima(8)
3:49.903 aoe m arcane_orb Fluffy_Pillow 51743.9/66800: 77% mana redirected_anima(8)
3:51.209 aoe p arcane_barrage Fluffy_Pillow 52648.8/66371: 79% mana arcane_charge(4), redirected_anima(7)
3:52.516 aoe o arcane_explosion Fluffy_Pillow 57038.6/66371: 86% mana redirected_anima(7)
3:53.822 aoe o arcane_explosion Fluffy_Pillow 53772.2/66371: 81% mana arcane_charge, redirected_anima(7)
3:55.130 aoe o arcane_explosion Fluffy_Pillow 50182.3/65943: 76% mana arcane_charge(2), redirected_anima(6)
3:56.436 aoe o arcane_explosion Fluffy_Pillow 46904.8/65943: 71% mana arcane_charge(3), redirected_anima(6)
3:57.742 aoe p arcane_barrage Fluffy_Pillow 43910.7/66371: 66% mana arcane_charge(4), redirected_anima(7)
3:59.048 aoe o arcane_explosion Fluffy_Pillow 48299.2/66371: 73% mana redirected_anima(7)
4:00.354 aoe o arcane_explosion Fluffy_Pillow 45032.8/66371: 68% mana arcane_charge, clearcasting, redirected_anima(7)
4:01.662 aoe o arcane_explosion Fluffy_Pillow 46769.1/66371: 70% mana arcane_charge(2), redirected_anima(7)
4:02.969 aoe o arcane_explosion Fluffy_Pillow 43504.1/66371: 66% mana arcane_charge(3), clearcasting, redirected_anima(7)
4:04.278 aoe p arcane_barrage Fluffy_Pillow 45241.7/66371: 68% mana arcane_charge(4), redirected_anima(7)
4:05.585 aoe j touch_of_the_magi Fluffy_Pillow 49631.5/66371: 75% mana redirected_anima(7)
4:06.891 aoe l rune_of_power Fluffy_Pillow 48865.1/66371: 74% mana arcane_charge(4), redirected_anima(7)
4:08.197 aoe p arcane_barrage Fluffy_Pillow 50598.7/66371: 76% mana arcane_charge(4), rune_of_power, redirected_anima(7)
4:09.504 aoe o arcane_explosion Fluffy_Pillow 54988.5/66371: 83% mana rune_of_power, redirected_anima(7)
4:10.811 aoe o arcane_explosion Fluffy_Pillow 51723.5/66371: 78% mana arcane_charge, rune_of_power, redirected_anima(7)
4:12.116 aoe o arcane_explosion Fluffy_Pillow 48455.8/66371: 73% mana arcane_charge(2), clearcasting, rune_of_power, redirected_anima(7)
4:13.422 aoe o arcane_explosion Fluffy_Pillow 50189.4/66371: 76% mana arcane_charge(3), rune_of_power, redirected_anima(7)
4:14.729 aoe p arcane_barrage Fluffy_Pillow 46924.3/66371: 71% mana arcane_charge(4), rune_of_power, redirected_anima(7)
4:16.035 aoe m arcane_orb Fluffy_Pillow 49324.8/63800: 77% mana rune_of_power, redirected_anima
4:17.342 aoe p arcane_barrage Fluffy_Pillow 50492.5/63800: 79% mana arcane_charge(4), rune_of_power, redirected_anima
4:18.649 aoe o arcane_explosion Fluffy_Pillow 55079.8/64229: 86% mana rune_of_power, redirected_anima(2)
4:19.955 aoe o arcane_explosion Fluffy_Pillow 51757.4/64229: 81% mana arcane_charge, clearcasting, rune_of_power, redirected_anima(2)
4:21.263 aoe o arcane_explosion Fluffy_Pillow 53437.7/64229: 83% mana arcane_charge(2), redirected_anima(2)
4:22.571 aoe o arcane_explosion Fluffy_Pillow 50117.9/64229: 78% mana arcane_charge(3), redirected_anima(2)
4:23.878 aoe p arcane_barrage Fluffy_Pillow 46796.8/64229: 73% mana arcane_charge(4), redirected_anima(2)
4:25.185 aoe o arcane_explosion Fluffy_Pillow 51044.9/64229: 79% mana redirected_anima(2)
4:26.491 aoe o arcane_explosion Fluffy_Pillow 47404.1/63800: 74% mana arcane_charge, clearcasting, redirected_anima
4:27.797 aoe o arcane_explosion Fluffy_Pillow 49070.6/63800: 77% mana arcane_charge(2), redirected_anima
4:29.105 shared_cds r use_mana_gem NightFae_Niya 45739.6/63800: 72% mana arcane_charge(3), redirected_anima
4:29.105 aoe o arcane_explosion Fluffy_Pillow 52119.6/63800: 82% mana arcane_charge(3), redirected_anima
4:30.414 aoe n shifting_power Fluffy_Pillow 48789.9/63800: 76% mana arcane_charge(4), redirected_anima
4:34.160 aoe p arcane_barrage Fluffy_Pillow 53128.1/66371: 80% mana arcane_charge(4), redirected_anima(7)
4:35.466 aoe m arcane_orb Fluffy_Pillow 57516.6/66371: 87% mana redirected_anima(7)
4:36.773 aoe p arcane_barrage Fluffy_Pillow 58751.5/66371: 89% mana arcane_charge(4), redirected_anima(7)
4:38.081 aoe o arcane_explosion Fluffy_Pillow 63142.7/66371: 95% mana redirected_anima(7)
4:39.389 aoe o arcane_explosion Fluffy_Pillow 59878.9/66371: 90% mana arcane_charge, clearcasting, redirected_anima(7)
4:40.694 aoe o arcane_explosion Fluffy_Pillow 61611.2/66371: 93% mana arcane_charge(2), redirected_anima(7)
4:41.999 aoe o arcane_explosion Fluffy_Pillow 58343.5/66371: 88% mana arcane_charge(3), redirected_anima(7)
4:43.306 aoe p arcane_barrage Fluffy_Pillow 55078.5/66371: 83% mana arcane_charge(4), redirected_anima(7)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="NightFae_Niya"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=night_fae
soulbind=322721//arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Venthyr_Nadjia : 16527 dps, 4641 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16526.7 16526.7 24.1 / 0.146% 1484.7 / 9.0% 7.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
2094.4 1990.3 Mana 0.00% 50.4 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_Nadjia 16527
Arcane Barrage 5695 34.5% 57.8 5.20sec 29641 24253 Direct 288.4 4984 9929 5939 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.76 288.36 0.00 0.00 1.2222 0.0000 1712119.16 1712119.16 0.00% 24253.04 24253.04
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.69% 232.69 175 294 4983.54 2082 25140 4980.39 4472 5448 1159542 1159542 0.00%
crit 19.31% 55.67 31 85 9928.53 4164 50280 9922.41 7416 12659 552578 552578 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:57.75
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
    rotation
    [s]:0.00
Arcane Blast 0 0.0% 0.0 0.00sec 2296 2255 Direct 0.0 2296 0 2296 0.0%

Stats Details: Arcane Blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 0.00 0.00 1.8010 0.0000 2.26 2.26 0.00% 2255.20 2255.20
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 0.00 0 1 2295.79 2296 2296 2.26 0 2296 2 2 0.00%

Action Details: Arcane Blast

  • id:30451
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1375.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.457000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:30451
  • name:Arcane Blast
  • school:arcane
  • tooltip:
  • description:Blasts the target with energy, dealing {$30451s1=0 + 45.7%} Arcane damage. Each Arcane Charge increases damage by {$36032s1=60}% and mana cost by {$36032s5=100}%, and reduces cast time by {$36032s4=8}%. |cFFFFFFFFGenerates 1 Arcane Charge.|r

Action Priority List

    rotation
    [r]:0.00
Arcane Echo 463 2.8% 43.8 6.45sec 3179 0 Direct 218.9 534 1069 636 19.1%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.78 218.92 0.00 0.00 0.0000 0.0000 139190.15 139190.15 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.87% 177.05 123 220 533.65 316 664 532.95 498 557 94458 94458 0.00%
crit 19.13% 41.87 18 64 1068.52 633 1329 1067.73 926 1185 44733 44733 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 7734 46.8% 156.9 1.89sec 14813 12163 Direct 784.5 2484 4970 2963 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 156.89 784.46 0.00 0.00 1.2180 0.0000 2324118.69 2324118.69 0.00% 12162.56 12162.56
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 633.21 489 777 2483.70 1958 4112 2483.82 2401 2563 1572501 1572501 0.00%
crit 19.28% 151.25 100 205 4969.55 3916 8223 4970.01 4535 5378 751617 751617 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:156.90
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1368) 0.0% (8.3%) 13.2 23.41sec 31097 25254

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.21 0.00 0.00 0.00 1.2314 0.0000 0.00 0.00 0.00% 25254.16 25254.16

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [n]:13.21
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1368 8.3% 65.9 23.41sec 6230 0 Direct 65.9 5233 10452 6230 19.1%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 65.95 65.95 0.00 0.00 0.0000 0.0000 410885.17 410885.17 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.86% 53.33 36 72 5232.59 3869 8126 5233.57 4514 5915 278957 278957 0.00%
crit 19.14% 12.62 3 25 10451.60 7739 16251 10470.77 7739 13639 131928 131928 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (69) 0.0% (0.4%) 14.7 1.77sec 1388 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.67 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 69 0.4% 14.7 1.77sec 1388 0 Direct 14.7 1164 2327 1388 19.3%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.67 14.67 0.00 0.00 0.0000 0.0000 20360.65 20360.65 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 11.84 4 19 1163.53 1164 1164 1163.53 1164 1164 13773 13773 0.00%
crit 19.30% 2.83 0 9 2327.06 2327 2327 2235.63 0 2327 6588 6588 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1781 20.6%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1786.12 1786.12 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.37% 0.79 0 1 1480.68 1481 1481 1175.23 0 1481 1175 1175 0.00%
crit 20.63% 0.21 0 1 2961.35 2961 2961 610.89 0 2961 611 611 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (19) 0.0% (0.1%) 1.0 0.00sec 5777 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 144  / 19 0.1% 90.0 1.29sec 64 49 Direct 90.0 54 108 64 19.0%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5777.34 5777.34 0.00% 49.05 49.05
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.95% 72.86 57 84 53.94 43 60 53.94 52 56 3930 3930 0.00%
crit 19.05% 17.14 6 33 107.77 86 120 107.71 95 120 1847 1847 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Mirrors of Torment 0 (139) 0.0% (0.8%) 2.9 129.43sec 14517 11799

Stats Details: Mirrors Of Torment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 1.2306 0.0000 0.00 0.00 0.00% 11798.64 11798.64

Action Details: Mirrors Of Torment

  • id:314793
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • school:shadow
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by {$320035s3=15}%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].

Action Priority List

    aoe
    [j]:2.88
  • if_expr:(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
    Agonizing Backlash 69 0.4% 5.7 52.75sec 3663 0 Direct 5.7 3102 6147 3663 18.4%

Stats Details: Agonizing Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.67 5.67 0.00 0.00 0.0000 0.0000 20758.59 20758.59 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.56% 4.62 1 6 3102.06 1739 3651 3094.64 2086 3651 14334 14334 0.00%
crit 18.44% 1.05 0 4 6147.11 3477 7302 4208.73 0 7302 6424 6424 0.00%

Action Details: Agonizing Backlash

  • id:320035
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:320035
  • name:Agonizing Backlash
  • school:shadow
  • tooltip:Movement speed and cast speed slowed by {$s3=15}%.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
    Tormenting Backlash 70 0.4% 2.8 131.34sec 7585 0 Direct 2.8 6406 12793 7581 18.5%

Stats Details: Tormenting Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.76 2.76 0.00 0.00 0.0000 0.0000 20937.81 20937.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 81.53% 2.25 0 3 6405.85 6126 6563 6302.33 0 6563 14416 14416 0.00%
crit 18.47% 0.51 0 3 12793.43 12251 13126 5340.29 0 13126 6522 6522 0.00%

Action Details: Tormenting Backlash

  • id:317589
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.510000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:317589
  • name:Tormenting Backlash
  • school:shadow
  • tooltip:Rooted and Silenced.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
Touch of the Magi 0 (1034) 0.0% (6.3%) 6.2 51.76sec 49957 41256

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.22 0.00 0.00 0.00 1.2110 0.0000 0.00 0.00 0.00% 41256.13 41256.13

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.23
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 1034 6.3% 6.2 51.62sec 49957 0 Direct 31.0 10021 0 10021 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.22 31.03 0.00 0.00 0.0000 0.0000 310782.45 310782.45 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 31.03 25 35 10021.19 656 52463 10002.71 6688 13080 310782 310782 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:30417.36
  • base_dd_max:30417.36
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Venthyr_Nadjia
Arcane Power 2.9 127.36sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.87
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.9 254.60sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.87 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [v]:1.87
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.1 155.98sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.14 0.00 6.79 0.00 4.1952 0.7030 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:1.14
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [u]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.1 49.91sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.08 0.00 0.00 0.00 1.2096 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:6.10
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.89sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.75 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Nadjia
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [t]:2.75
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 58.5 183.8 5.1sec 1.2sec 3.8sec 73.42% 0.00% 27.3 (28.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 10.2s

Stack Uptimes

  • arcane_charge_1:18.76%
  • arcane_charge_2:16.93%
  • arcane_charge_3:16.47%
  • arcane_charge_4:21.26%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 127.2sec 127.2sec 14.7sec 14.00% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.3s / 132.2s
  • trigger_min/max:121.3s / 132.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:14.00%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.9 0.0 254.4sec 254.4sec 11.7sec 7.21% 12.74% 0.0 (0.0) 1.8

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:251.4s / 259.1s
  • trigger_min/max:251.4s / 259.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • berserking_1:7.21%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.7 0.2 11.8sec 11.7sec 1.9sec 15.88% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:15.72%
  • clearcasting_2:0.16%
  • clearcasting_3:0.03%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Euphoria 3.4 0.0 78.0sec 78.0sec 9.9sec 11.19% 0.00% 0.0 (0.0) 3.3

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_euphoria
  • max_stacks:1
  • base duration:10.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:78.0s / 78.0s
  • trigger_min/max:78.0s / 78.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 10.0s

Stack Uptimes

  • euphoria_1:11.19%

Spelldata

  • id:331937
  • name:Euphoria
  • tooltip:Filled with the thrill of battle, increasing Haste by $w1%.
  • description:{$@spelldesc331586=While in combat, you gain a stack of Thrill Seeker every $t1 sec, or {$s1=4} stacks on killing an enemy. At {$331939u=40} stacks Thrill Seeker is consumed to grant you Euphoria, increasing your Haste by {$331937s1=20}% for {$331937d=10 seconds}. Thrill Seeker decays rapidly while you are not in combat.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Evocation 1.1 0.0 170.6sec 170.6sec 4.2sec 1.59% 0.00% 4.5 (4.5) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:105.6s / 259.1s
  • trigger_min/max:105.6s / 259.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:1.59%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.43% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.43%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 34.7sec 34.7sec 11.8sec 35.13% 0.00% 0.0 (0.0) 8.6

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.5s / 51.8s
  • trigger_min/max:13.5s / 51.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:35.13%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Thrill Seeker 4.4 145.4 78.0sec 2.0sec 66.5sec 97.06% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_thrill_seeker
  • max_stacks:40
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:2.00

Trigger Details

  • interval_min/max:78.0s / 78.0s
  • trigger_min/max:2.0s / 2.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 76.0s

Stack Uptimes

  • thrill_seeker_1:2.93%
  • thrill_seeker_3:2.92%
  • thrill_seeker_4:2.90%
  • thrill_seeker_5:2.88%
  • thrill_seeker_6:2.85%
  • thrill_seeker_7:2.82%
  • thrill_seeker_8:2.80%
  • thrill_seeker_9:2.78%
  • thrill_seeker_10:2.75%
  • thrill_seeker_11:2.73%
  • thrill_seeker_12:2.71%
  • thrill_seeker_13:2.68%
  • thrill_seeker_14:2.66%
  • thrill_seeker_15:2.64%
  • thrill_seeker_16:2.62%
  • thrill_seeker_17:2.60%
  • thrill_seeker_18:2.57%
  • thrill_seeker_19:2.54%
  • thrill_seeker_20:2.53%
  • thrill_seeker_21:2.50%
  • thrill_seeker_22:2.49%
  • thrill_seeker_23:2.47%
  • thrill_seeker_24:2.45%
  • thrill_seeker_25:2.43%
  • thrill_seeker_26:2.42%
  • thrill_seeker_27:2.41%
  • thrill_seeker_28:2.39%
  • thrill_seeker_29:2.38%
  • thrill_seeker_30:2.37%
  • thrill_seeker_31:2.36%
  • thrill_seeker_32:2.34%
  • thrill_seeker_33:2.34%
  • thrill_seeker_34:2.33%
  • thrill_seeker_35:2.32%
  • thrill_seeker_36:2.31%
  • thrill_seeker_37:2.30%
  • thrill_seeker_38:2.29%
  • thrill_seeker_39:2.28%

Spelldata

  • id:331939
  • name:Thrill Seeker
  • tooltip:At {$u=40} stacks, you will gain Euphoria.
  • description:{$@spelldesc331586=While in combat, you gain a stack of Thrill Seeker every $t1 sec, or {$s1=4} stacks on killing an enemy. At {$331939u=40} stacks Thrill Seeker is consumed to grant you Euphoria, increasing your Haste by {$331937s1=20}% for {$331937d=10 seconds}. Thrill Seeker decays rapidly while you are not in combat.}
  • max_stacks:40
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 2 0.00% 0.00% 1.64%
Arcane Barrage Arcane Charge 4 100.00% 98.36% 100.00%
Arcane Blast Arcane Charge 1 0.10% 0.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.41% 0.79% 6.75% 0.8s 0.0s 4.9s
Conserve Phase 100.00% 100.00% 100.00% 300.7s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.660120.091239.937
Evocation140.48615.596344.449212.371134.538344.449
Rune of Power5.9870.06522.31937.61722.72449.364
Touch of the Magi4.7830.00022.65431.07821.41948.059
Arcane Power5.5251.31312.17015.9947.29521.432
Arcane Barrage2.7560.0008.927160.277125.776196.166
Arcane Orb3.4060.01210.48845.27332.23758.544
Mirrors of Torment24.9030.00071.47872.63466.897133.856

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_Nadjia
mana_regen Mana 530.87 368999.17 61.68% 695.08 11411.60 3.00%
Evocation Mana 53.07 54732.16 9.15% 1031.29 0.00 0.00%
Mana Gem Mana 2.75 17424.08 2.91% 6337.14 0.00 0.00%
Arcane Barrage Mana 57.76 139609.32 23.34% 2417.25 6790.93 4.64%
Mirrors of Torment Mana 8.44 17514.06 2.93% 2076.07 3870.42 18.10%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1990.31 2094.39 22077.7 32079.5 196.5 63371.4
Usage Type Count Total Avg RPE APR
Venthyr_Nadjia
arcane_blast Mana 0.0 2.7 2750.0 2707.4 0.8
arcane_explosion Mana 156.9 601366.1 3832.8 3833.0 3.9
arcane_orb Mana 13.2 5919.2 448.1 448.0 69.4
mirrors_of_torment Mana 2.9 5748.5 2000.0 2001.4 7.3
touch_of_the_magi Mana 6.2 15544.0 2500.0 2498.6 20.0

Statistics & Data Analysis

Fight Length
Venthyr_Nadjia Fight Length
Count 1018
Mean 300.66
Minimum 240.09
Maximum 359.94
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
Venthyr_Nadjia Damage Per Second
Count 1018
Mean 16526.67
Minimum 15203.41
Maximum 17737.76
Spread ( max - min ) 2534.35
Range [ ( max - min ) / 2 * 100% ] 7.67%
Standard Deviation 393.0388
5th Percentile 15877.74
95th Percentile 17166.30
( 95th Percentile - 5th Percentile ) 1288.57
Mean Distribution
Standard Deviation 12.3186
95.00% Confidence Interval ( 16502.52 - 16550.81 )
Normalized 95.00% Confidence Interval ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 22
0.1% Error 2173
0.1 Scale Factor Error with Delta=300 1319
0.05 Scale Factor Error with Delta=300 5275
0.01 Scale Factor Error with Delta=300 131873
Priority Target DPS
Venthyr_Nadjia Priority Target Damage Per Second
Count 1018
Mean 4640.61
Minimum 4053.07
Maximum 5230.58
Spread ( max - min ) 1177.51
Range [ ( max - min ) / 2 * 100% ] 12.69%
Standard Deviation 174.1389
5th Percentile 4352.35
95th Percentile 4927.41
( 95th Percentile - 5th Percentile ) 575.06
Mean Distribution
Standard Deviation 5.4579
95.00% Confidence Interval ( 4629.91 - 4651.31 )
Normalized 95.00% Confidence Interval ( 99.77% - 100.23% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5410
0.1 Scale Factor Error with Delta=300 259
0.05 Scale Factor Error with Delta=300 1036
0.01 Scale Factor Error with Delta=300 25887
DPS(e)
Venthyr_Nadjia Damage Per Second (Effective)
Count 1018
Mean 16526.67
Minimum 15203.41
Maximum 17737.76
Spread ( max - min ) 2534.35
Range [ ( max - min ) / 2 * 100% ] 7.67%
Damage
Venthyr_Nadjia Damage
Count 1018
Mean 4960941.05
Minimum 3819478.88
Maximum 5980359.15
Spread ( max - min ) 2160880.27
Range [ ( max - min ) / 2 * 100% ] 21.78%
DTPS
Venthyr_Nadjia Damage Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_Nadjia Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_Nadjia Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_Nadjia Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_Nadjia Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_Nadjia Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_NadjiaTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_Nadjia Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
j 2.88 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.23 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.87 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 6.10 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
n 13.21 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 156.90 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 57.75 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 1.14 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
t 2.75 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
u 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
v 1.87 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjkluvpnpoooopoooopoooompooootpnpoooopoooopoooopoooopnpoooopoooopkmpoooopnpoooopoooopoooopnpoooopooqkmpnpoooopoooolpoooopnpoooopoooopooootpjkmpnpoooopoooopoooopnpoooopoooopoooopkmpnpoooopoooopoooopnpoooopoooopooqjklvpnpoooopoooompooootpnpo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Venthyr_Nadjia 63371.4/63371: 100% mana
Pre precombat R food Venthyr_Nadjia 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j mirrors_of_torment Fluffy_Pillow 62371.4/63371: 98% mana
0:01.306 aoe k touch_of_the_magi Fluffy_Pillow 61376.5/63371: 97% mana bloodlust
0:02.312 aoe l arcane_power Fluffy_Pillow 60151.5/63371: 95% mana bloodlust, arcane_charge(4), thrill_seeker
0:02.312 shared_cds u potion Fluffy_Pillow 60151.5/63371: 95% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker
0:02.312 shared_cds v berserking Fluffy_Pillow 60151.5/63371: 95% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker, potion_of_deathly_fixation
0:02.312 aoe p arcane_barrage Fluffy_Pillow 60151.5/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker, potion_of_deathly_fixation
0:03.228 aoe n arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, thrill_seeker, potion_of_deathly_fixation
0:04.143 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(3), potion_of_deathly_fixation
0:05.058 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, thrill_seeker(3), potion_of_deathly_fixation
0:05.973 aoe o arcane_explosion Fluffy_Pillow 62031.1/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, thrill_seeker(3), potion_of_deathly_fixation
0:06.889 aoe o arcane_explosion Fluffy_Pillow 60692.1/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(4), potion_of_deathly_fixation
0:07.804 aoe o arcane_explosion Fluffy_Pillow 59351.8/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(4), potion_of_deathly_fixation
0:08.718 aoe p arcane_barrage Fluffy_Pillow 58010.2/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(5), potion_of_deathly_fixation
0:09.633 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, thrill_seeker(5), potion_of_deathly_fixation
0:10.546 aoe o arcane_explosion Fluffy_Pillow 62028.6/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, thrill_seeker(6), potion_of_deathly_fixation
0:11.459 aoe o arcane_explosion Fluffy_Pillow 60685.8/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(6), potion_of_deathly_fixation
0:12.373 aoe o arcane_explosion Fluffy_Pillow 59344.2/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, thrill_seeker(7), potion_of_deathly_fixation
0:13.288 aoe p arcane_barrage Fluffy_Pillow 58003.9/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(7), potion_of_deathly_fixation
0:14.203 aoe o arcane_explosion Fluffy_Pillow 61698.4/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, thrill_seeker(8), potion_of_deathly_fixation
0:15.117 aoe o arcane_explosion Fluffy_Pillow 62891.7/63371: 99% mana bloodlust, arcane_charge, arcane_power, thrill_seeker(8), potion_of_deathly_fixation
0:16.125 aoe o arcane_explosion Fluffy_Pillow 61669.3/63371: 97% mana bloodlust, arcane_charge(2), arcane_power, clearcasting, thrill_seeker(9), potion_of_deathly_fixation
0:17.130 aoe o arcane_explosion Fluffy_Pillow 62943.1/63371: 99% mana bloodlust, arcane_charge(3), arcane_power, thrill_seeker(9), potion_of_deathly_fixation
0:18.137 aoe m rune_of_power Fluffy_Pillow 61719.4/63371: 97% mana bloodlust, arcane_charge(4), clearcasting, thrill_seeker(10), potion_of_deathly_fixation
0:19.143 aoe p arcane_barrage Fluffy_Pillow 62994.4/63371: 99% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, thrill_seeker(10), potion_of_deathly_fixation
0:20.150 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, clearcasting, rune_of_power, thrill_seeker(11), potion_of_deathly_fixation
0:21.157 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge, rune_of_power, thrill_seeker(11), potion_of_deathly_fixation
0:22.163 aoe o arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge(2), rune_of_power, thrill_seeker(12), potion_of_deathly_fixation
0:23.171 aoe o arcane_explosion Fluffy_Pillow 55924.0/63371: 88% mana bloodlust, arcane_charge(3), rune_of_power, thrill_seeker(12), potion_of_deathly_fixation
0:24.178 shared_cds t use_mana_gem Venthyr_Nadjia 52200.3/63371: 82% mana bloodlust, arcane_charge(4), rune_of_power, thrill_seeker(13), potion_of_deathly_fixation
0:24.178 aoe p arcane_barrage Fluffy_Pillow 58537.5/63371: 92% mana bloodlust, arcane_charge(4), rune_of_power, thrill_seeker(13), potion_of_deathly_fixation
0:25.184 aoe n arcane_orb Fluffy_Pillow 62347.4/63371: 98% mana bloodlust, rune_of_power, thrill_seeker(13), potion_of_deathly_fixation
0:26.191 aoe p arcane_barrage Fluffy_Pillow 63123.7/63371: 100% mana bloodlust, arcane_charge(4), rune_of_power, thrill_seeker(14), potion_of_deathly_fixation
0:27.200 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, thrill_seeker(14), potion_of_deathly_fixation
0:28.208 aoe o arcane_explosion Fluffy_Pillow 59649.0/63371: 94% mana bloodlust, arcane_charge, rune_of_power, thrill_seeker(15)
0:29.214 aoe o arcane_explosion Fluffy_Pillow 55924.0/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power, thrill_seeker(15)
0:30.221 aoe o arcane_explosion Fluffy_Pillow 52200.3/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power, thrill_seeker(16)
0:31.227 aoe p arcane_barrage Fluffy_Pillow 48475.4/63371: 76% mana bloodlust, arcane_charge(4), thrill_seeker(16)
0:32.232 aoe o arcane_explosion Fluffy_Pillow 52284.0/63371: 83% mana bloodlust, thrill_seeker(17)
0:33.238 aoe o arcane_explosion Fluffy_Pillow 48559.0/63371: 77% mana bloodlust, arcane_charge, thrill_seeker(17)
0:34.245 aoe o arcane_explosion Fluffy_Pillow 44835.3/63371: 71% mana bloodlust, arcane_charge(2), thrill_seeker(18)
0:35.251 aoe o arcane_explosion Fluffy_Pillow 41110.4/63371: 65% mana bloodlust, arcane_charge(3), thrill_seeker(18)
0:36.257 aoe p arcane_barrage Fluffy_Pillow 37385.4/63371: 59% mana bloodlust, arcane_charge(4), thrill_seeker(19)
0:37.264 aoe o arcane_explosion Fluffy_Pillow 41196.5/63371: 65% mana bloodlust, thrill_seeker(19)
0:38.269 aoe o arcane_explosion Fluffy_Pillow 37470.3/63371: 59% mana bloodlust, arcane_charge, thrill_seeker(20)
0:39.275 aoe o arcane_explosion Fluffy_Pillow 33745.3/63371: 53% mana bloodlust, arcane_charge(2), thrill_seeker(20)
0:40.283 aoe o arcane_explosion Fluffy_Pillow 30022.9/63371: 47% mana bloodlust, arcane_charge(3), thrill_seeker(21)
0:41.289 aoe p arcane_barrage Fluffy_Pillow 26297.9/63371: 41% mana arcane_charge(4), thrill_seeker(21)
0:42.596 aoe o arcane_explosion Fluffy_Pillow 30489.3/63371: 48% mana thrill_seeker(22)
0:43.903 aoe o arcane_explosion Fluffy_Pillow 27145.9/63371: 43% mana arcane_charge, clearcasting, thrill_seeker(22)
0:45.209 aoe o arcane_explosion Fluffy_Pillow 28801.1/63371: 45% mana arcane_charge(2), thrill_seeker(23)
0:46.515 aoe o arcane_explosion Fluffy_Pillow 25456.4/63371: 40% mana arcane_charge(3), thrill_seeker(24)
0:47.823 aoe p arcane_barrage Fluffy_Pillow 22114.2/63371: 35% mana arcane_charge(4), clearcasting, thrill_seeker(24)
0:49.129 aoe n arcane_orb Fluffy_Pillow 26304.3/63371: 42% mana clearcasting, thrill_seeker(25)
0:50.437 aoe p arcane_barrage Fluffy_Pillow 27462.1/63371: 43% mana arcane_charge(4), clearcasting, thrill_seeker(26)
0:51.744 aoe o arcane_explosion Fluffy_Pillow 31653.5/63371: 50% mana clearcasting, thrill_seeker(26)
0:53.052 aoe o arcane_explosion Fluffy_Pillow 33311.3/63371: 53% mana arcane_charge, thrill_seeker(27)
0:54.358 aoe o arcane_explosion Fluffy_Pillow 29966.5/63371: 47% mana arcane_charge(2), thrill_seeker(28)
0:55.663 aoe o arcane_explosion Fluffy_Pillow 26620.5/63371: 42% mana arcane_charge(3), clearcasting, thrill_seeker(28)
0:56.968 aoe p arcane_barrage Fluffy_Pillow 28274.5/63371: 45% mana arcane_charge(4), thrill_seeker(29)
0:58.277 aoe o arcane_explosion Fluffy_Pillow 32468.4/63371: 51% mana thrill_seeker(30)
0:59.584 aoe o arcane_explosion Fluffy_Pillow 29125.0/63371: 46% mana arcane_charge, thrill_seeker(30)
1:00.892 aoe o arcane_explosion Fluffy_Pillow 25782.8/63371: 41% mana arcane_charge(2), clearcasting, thrill_seeker(31)
1:02.197 aoe o arcane_explosion Fluffy_Pillow 27436.8/63371: 43% mana arcane_charge(3), thrill_seeker(32)
1:03.503 aoe p arcane_barrage Fluffy_Pillow 24092.0/63371: 38% mana arcane_charge(4), thrill_seeker(32)
1:04.810 aoe k touch_of_the_magi Fluffy_Pillow 28283.4/63371: 45% mana thrill_seeker(33)
1:06.118 aoe m rune_of_power Fluffy_Pillow 27441.2/63371: 43% mana arcane_charge(4), thrill_seeker(34)
1:07.423 aoe p arcane_barrage Fluffy_Pillow 29095.2/63371: 46% mana arcane_charge(4), rune_of_power, thrill_seeker(34)
1:08.729 aoe o arcane_explosion Fluffy_Pillow 33285.3/63371: 53% mana rune_of_power, thrill_seeker(35)
1:10.038 aoe o arcane_explosion Fluffy_Pillow 29944.4/63371: 47% mana arcane_charge, rune_of_power, thrill_seeker(36)
1:11.343 aoe o arcane_explosion Fluffy_Pillow 26598.4/63371: 42% mana arcane_charge(2), rune_of_power, thrill_seeker(36)
1:12.649 aoe o arcane_explosion Fluffy_Pillow 23253.6/63371: 37% mana arcane_charge(3), rune_of_power, thrill_seeker(37)
1:13.955 aoe p arcane_barrage Fluffy_Pillow 19908.9/63371: 31% mana arcane_charge(4), rune_of_power, thrill_seeker(37)
1:15.263 aoe n arcane_orb Fluffy_Pillow 24101.6/63371: 38% mana rune_of_power, thrill_seeker(38)
1:16.569 aoe p arcane_barrage Fluffy_Pillow 25256.8/63371: 40% mana arcane_charge(4), rune_of_power, thrill_seeker(39)
1:17.875 aoe o arcane_explosion Fluffy_Pillow 29446.9/63371: 46% mana rune_of_power, thrill_seeker(39)
1:19.183 aoe o arcane_explosion Fluffy_Pillow 26104.7/63371: 41% mana arcane_charge, rune_of_power, euphoria
1:20.272 aoe o arcane_explosion Fluffy_Pillow 22485.0/63371: 35% mana arcane_charge(2), thrill_seeker, euphoria
1:21.360 aoe o arcane_explosion Fluffy_Pillow 18863.9/63371: 30% mana arcane_charge(3), thrill_seeker, euphoria
1:22.450 aoe p arcane_barrage Fluffy_Pillow 15245.4/63371: 24% mana arcane_charge(4), thrill_seeker(3), euphoria
1:23.540 aoe o arcane_explosion Fluffy_Pillow 19161.8/63371: 30% mana thrill_seeker(3), euphoria
1:24.629 aoe o arcane_explosion Fluffy_Pillow 15542.0/63371: 25% mana arcane_charge, thrill_seeker(4), euphoria
1:25.718 aoe o arcane_explosion Fluffy_Pillow 11922.2/63371: 19% mana arcane_charge(2), thrill_seeker(4), euphoria
1:26.809 aoe o arcane_explosion Fluffy_Pillow 8305.0/63371: 13% mana arcane_charge(3), clearcasting, thrill_seeker(5), euphoria
1:27.898 aoe p arcane_barrage Fluffy_Pillow 9685.2/63371: 15% mana arcane_charge(4), thrill_seeker(5), euphoria
1:28.989 aoe o arcane_explosion Fluffy_Pillow 13602.9/63371: 21% mana thrill_seeker(6)
1:30.296 aoe o arcane_explosion Fluffy_Pillow 10259.4/63371: 16% mana arcane_charge, thrill_seeker(7)
1:31.604 aoe o arcane_explosion Fluffy_Pillow 6917.2/63371: 11% mana arcane_charge(2), thrill_seeker(7)
1:32.911 aoe o arcane_explosion Fluffy_Pillow 3573.7/63371: 6% mana arcane_charge(3), clearcasting, thrill_seeker(8)
1:34.218 aoe p arcane_barrage Fluffy_Pillow 5230.2/63371: 8% mana arcane_charge(4), thrill_seeker(9)
1:35.523 aoe n arcane_orb Fluffy_Pillow 9419.1/63371: 15% mana thrill_seeker(9)
1:36.829 aoe p arcane_barrage Fluffy_Pillow 10574.4/63371: 17% mana arcane_charge(4), thrill_seeker(10)
1:38.134 aoe o arcane_explosion Fluffy_Pillow 14763.2/63371: 23% mana thrill_seeker(11)
1:39.440 aoe o arcane_explosion Fluffy_Pillow 11418.5/63371: 18% mana arcane_charge, clearcasting, thrill_seeker(11)
1:40.744 aoe o arcane_explosion Fluffy_Pillow 13071.2/63371: 21% mana arcane_charge(2), thrill_seeker(12)
1:42.049 aoe o arcane_explosion Fluffy_Pillow 9725.2/63371: 15% mana arcane_charge(3), thrill_seeker(13)
1:43.356 aoe p arcane_barrage Fluffy_Pillow 6381.7/63371: 10% mana arcane_charge(4), thrill_seeker(13)
1:44.661 aoe o arcane_explosion Fluffy_Pillow 10570.6/63371: 17% mana thrill_seeker(14)
1:45.967 aoe o arcane_explosion Fluffy_Pillow 7225.8/63371: 11% mana arcane_charge, thrill_seeker(14)
1:47.273 aoe q evocation Venthyr_Nadjia 3881.1/63371: 6% mana arcane_charge(2), thrill_seeker(15)
1:51.618 aoe k touch_of_the_magi Fluffy_Pillow 57727.0/63371: 91% mana arcane_charge(2), thrill_seeker(17)
1:52.924 aoe m rune_of_power Fluffy_Pillow 56882.3/63371: 90% mana arcane_charge(4), thrill_seeker(18)
1:54.231 aoe p arcane_barrage Fluffy_Pillow 58538.8/63371: 92% mana arcane_charge(4), rune_of_power, thrill_seeker(19)
1:55.538 aoe n arcane_orb Fluffy_Pillow 62730.2/63371: 99% mana rune_of_power, thrill_seeker(19)
1:56.846 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge(4), rune_of_power, thrill_seeker(20)
1:58.152 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power, thrill_seeker(21)
1:59.461 aoe o arcane_explosion Fluffy_Pillow 60030.5/63371: 95% mana arcane_charge, clearcasting, rune_of_power, thrill_seeker(21)
2:00.767 aoe o arcane_explosion Fluffy_Pillow 61685.8/63371: 97% mana arcane_charge(2), rune_of_power, thrill_seeker(22)
2:02.072 aoe o arcane_explosion Fluffy_Pillow 58339.7/63371: 92% mana arcane_charge(3), rune_of_power, thrill_seeker(23)
2:03.379 aoe p arcane_barrage Fluffy_Pillow 54996.3/63371: 87% mana arcane_charge(4), clearcasting, rune_of_power, thrill_seeker(23)
2:04.686 aoe o arcane_explosion Fluffy_Pillow 59187.7/63371: 93% mana clearcasting, rune_of_power, thrill_seeker(24)
2:05.992 aoe o arcane_explosion Fluffy_Pillow 60842.9/63371: 96% mana arcane_charge, rune_of_power, thrill_seeker(24)
2:07.298 aoe o arcane_explosion Fluffy_Pillow 57498.2/63371: 91% mana arcane_charge(2), thrill_seeker(25)
2:08.604 aoe o arcane_explosion Fluffy_Pillow 54153.4/63371: 85% mana arcane_charge(3), thrill_seeker(26)
2:09.911 aoe l arcane_power Fluffy_Pillow 50810.0/63371: 80% mana arcane_charge(4), thrill_seeker(26)
2:09.911 aoe p arcane_barrage Fluffy_Pillow 50810.0/63371: 80% mana arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(26)
2:11.216 aoe o arcane_explosion Fluffy_Pillow 54998.8/63371: 87% mana arcane_power, rune_of_power, thrill_seeker(27)
2:12.521 aoe o arcane_explosion Fluffy_Pillow 54152.8/63371: 85% mana arcane_charge, arcane_power, rune_of_power, thrill_seeker(28)
2:13.827 aoe o arcane_explosion Fluffy_Pillow 53308.1/63371: 84% mana arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(28)
2:15.134 aoe o arcane_explosion Fluffy_Pillow 52464.6/63371: 83% mana arcane_charge(3), arcane_power, clearcasting, rune_of_power, thrill_seeker(29)
2:16.440 aoe p arcane_barrage Fluffy_Pillow 54119.9/63371: 85% mana arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(30)
2:17.745 aoe n arcane_orb Fluffy_Pillow 58308.7/63371: 92% mana arcane_power, rune_of_power, thrill_seeker(30)
2:19.052 aoe p arcane_barrage Fluffy_Pillow 59715.3/63371: 94% mana arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(31)
2:20.359 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_power, rune_of_power, thrill_seeker(32)
2:21.664 aoe o arcane_explosion Fluffy_Pillow 62525.4/63371: 99% mana arcane_charge, arcane_power, rune_of_power, thrill_seeker(32)
2:22.970 aoe o arcane_explosion Fluffy_Pillow 61680.7/63371: 97% mana arcane_charge(2), arcane_power, thrill_seeker(33)
2:24.277 aoe o arcane_explosion Fluffy_Pillow 60837.2/63371: 96% mana arcane_charge(3), arcane_power, clearcasting, thrill_seeker(34)
2:25.582 aoe p arcane_barrage Fluffy_Pillow 62491.2/63371: 99% mana arcane_charge(4), thrill_seeker(34)
2:26.890 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana thrill_seeker(35)
2:28.196 aoe o arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge, clearcasting, thrill_seeker(36)
2:29.501 aoe o arcane_explosion Fluffy_Pillow 61680.7/63371: 97% mana arcane_charge(2), thrill_seeker(36)
2:30.807 aoe o arcane_explosion Fluffy_Pillow 58335.9/63371: 92% mana arcane_charge(3), thrill_seeker(37)
2:32.116 aoe p arcane_barrage Fluffy_Pillow 54995.0/63371: 87% mana arcane_charge(4), clearcasting, thrill_seeker(38)
2:33.423 aoe o arcane_explosion Fluffy_Pillow 59186.4/63371: 93% mana clearcasting, thrill_seeker(38)
2:34.730 aoe o arcane_explosion Fluffy_Pillow 60842.9/63371: 96% mana arcane_charge, thrill_seeker(39)
2:36.036 aoe o arcane_explosion Fluffy_Pillow 57498.2/63371: 91% mana arcane_charge(2), euphoria
2:37.126 aoe o arcane_explosion Fluffy_Pillow 53879.7/63371: 85% mana arcane_charge(3), euphoria
2:38.214 shared_cds t use_mana_gem Venthyr_Nadjia 50258.6/63371: 79% mana arcane_charge(4), thrill_seeker, euphoria
2:38.214 aoe p arcane_barrage Fluffy_Pillow 56595.8/63371: 89% mana arcane_charge(4), thrill_seeker, euphoria
2:39.303 aoe j mirrors_of_torment Fluffy_Pillow 60510.9/63371: 95% mana thrill_seeker, euphoria
2:40.392 aoe k touch_of_the_magi Fluffy_Pillow 59891.1/63371: 95% mana thrill_seeker(3), euphoria
2:41.482 aoe m rune_of_power Fluffy_Pillow 58772.6/63371: 93% mana arcane_charge(4), thrill_seeker(3), euphoria
2:42.572 aoe p arcane_barrage Fluffy_Pillow 62689.0/63371: 99% mana arcane_charge(4), rune_of_power, thrill_seeker(4), euphoria
2:43.662 aoe n arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power, thrill_seeker(4), euphoria
2:44.752 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge(4), rune_of_power, thrill_seeker(5), euphoria
2:45.842 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power, thrill_seeker(5), euphoria
2:46.931 aoe o arcane_explosion Fluffy_Pillow 59751.7/63371: 94% mana arcane_charge, rune_of_power, thrill_seeker(6)
2:48.239 aoe o arcane_explosion Fluffy_Pillow 58944.3/63371: 93% mana arcane_charge(2), rune_of_power, thrill_seeker(7)
2:49.545 aoe o arcane_explosion Fluffy_Pillow 55599.6/63371: 88% mana arcane_charge(3), clearcasting, rune_of_power, thrill_seeker(7)
2:50.849 aoe p arcane_barrage Fluffy_Pillow 57252.3/63371: 90% mana arcane_charge(4), rune_of_power, thrill_seeker(8)
2:52.155 aoe o arcane_explosion Fluffy_Pillow 61442.4/63371: 97% mana rune_of_power, thrill_seeker(9)
2:53.462 aoe o arcane_explosion Fluffy_Pillow 58098.9/63371: 92% mana arcane_charge, rune_of_power, thrill_seeker(9)
2:54.767 aoe o arcane_explosion Fluffy_Pillow 57287.8/63371: 90% mana arcane_charge(2), thrill_seeker(10)
2:56.074 aoe o arcane_explosion Fluffy_Pillow 53944.3/63371: 85% mana arcane_charge(3), thrill_seeker(11)
2:57.381 aoe p arcane_barrage Fluffy_Pillow 50600.9/63371: 80% mana arcane_charge(4), thrill_seeker(11)
2:58.686 aoe o arcane_explosion Fluffy_Pillow 54789.7/63371: 86% mana thrill_seeker(12)
2:59.992 aoe o arcane_explosion Fluffy_Pillow 51445.0/63371: 81% mana arcane_charge, thrill_seeker(12)
3:01.300 aoe o arcane_explosion Fluffy_Pillow 48102.8/63371: 76% mana arcane_charge(2), thrill_seeker(13)
3:02.609 aoe o arcane_explosion Fluffy_Pillow 44761.8/63371: 71% mana arcane_charge(3), thrill_seeker(14)
3:03.916 aoe p arcane_barrage Fluffy_Pillow 41418.4/63371: 65% mana arcane_charge(4), thrill_seeker(14)
3:05.224 aoe n arcane_orb Fluffy_Pillow 45611.0/63371: 72% mana thrill_seeker(15)
3:06.531 aoe p arcane_barrage Fluffy_Pillow 46767.5/63371: 74% mana arcane_charge(4), thrill_seeker(16)
3:07.837 aoe o arcane_explosion Fluffy_Pillow 50957.7/63371: 80% mana thrill_seeker(16)
3:09.143 aoe o arcane_explosion Fluffy_Pillow 47612.9/63371: 75% mana arcane_charge, thrill_seeker(17)
3:10.447 aoe o arcane_explosion Fluffy_Pillow 44265.7/63371: 70% mana arcane_charge(2), thrill_seeker(18)
3:11.754 aoe o arcane_explosion Fluffy_Pillow 40922.2/63371: 65% mana arcane_charge(3), thrill_seeker(18)
3:13.062 aoe p arcane_barrage Fluffy_Pillow 37580.0/63371: 59% mana arcane_charge(4), thrill_seeker(19)
3:14.368 aoe o arcane_explosion Fluffy_Pillow 41770.1/63371: 66% mana thrill_seeker(20)
3:15.674 aoe o arcane_explosion Fluffy_Pillow 38425.4/63371: 61% mana arcane_charge, thrill_seeker(20)
3:16.979 aoe o arcane_explosion Fluffy_Pillow 35079.4/63371: 55% mana arcane_charge(2), thrill_seeker(21)
3:18.285 aoe o arcane_explosion Fluffy_Pillow 31734.6/63371: 50% mana arcane_charge(3), thrill_seeker(22)
3:19.590 aoe p arcane_barrage Fluffy_Pillow 28388.6/63371: 45% mana arcane_charge(4), thrill_seeker(22)
3:20.896 aoe o arcane_explosion Fluffy_Pillow 32578.7/63371: 51% mana thrill_seeker(23)
3:22.203 aoe o arcane_explosion Fluffy_Pillow 29235.3/63371: 46% mana arcane_charge, thrill_seeker(24)
3:23.510 aoe o arcane_explosion Fluffy_Pillow 25891.8/63371: 41% mana arcane_charge(2), thrill_seeker(24)
3:24.817 aoe o arcane_explosion Fluffy_Pillow 22548.3/63371: 36% mana arcane_charge(3), thrill_seeker(25)
3:26.124 aoe p arcane_barrage Fluffy_Pillow 19204.8/63371: 30% mana arcane_charge(4), thrill_seeker(26)
3:27.431 aoe k touch_of_the_magi Fluffy_Pillow 23396.2/63371: 37% mana thrill_seeker(26)
3:28.736 aoe m rune_of_power Fluffy_Pillow 22550.2/63371: 36% mana arcane_charge(4), thrill_seeker(27)
3:30.043 aoe p arcane_barrage Fluffy_Pillow 24206.8/63371: 38% mana arcane_charge(4), rune_of_power, thrill_seeker(28)
3:31.349 aoe n arcane_orb Fluffy_Pillow 28396.9/63371: 45% mana rune_of_power, thrill_seeker(28)
3:32.657 aoe p arcane_barrage Fluffy_Pillow 29554.7/63371: 47% mana arcane_charge(4), rune_of_power, thrill_seeker(29)
3:33.965 aoe o arcane_explosion Fluffy_Pillow 33747.3/63371: 53% mana rune_of_power, thrill_seeker(29)
3:35.271 aoe o arcane_explosion Fluffy_Pillow 30402.6/63371: 48% mana arcane_charge, clearcasting, rune_of_power, thrill_seeker(30)
3:36.577 aoe o arcane_explosion Fluffy_Pillow 32057.8/63371: 51% mana arcane_charge(2), rune_of_power, thrill_seeker(31)
3:37.884 aoe o arcane_explosion Fluffy_Pillow 28714.4/63371: 45% mana arcane_charge(3), rune_of_power, thrill_seeker(31)
3:39.190 aoe p arcane_barrage Fluffy_Pillow 25369.6/63371: 40% mana arcane_charge(4), rune_of_power, thrill_seeker(32)
3:40.496 aoe o arcane_explosion Fluffy_Pillow 29559.8/63371: 47% mana rune_of_power, thrill_seeker(33)
3:41.803 aoe o arcane_explosion Fluffy_Pillow 26216.3/63371: 41% mana arcane_charge, clearcasting, rune_of_power, thrill_seeker(33)
3:43.111 aoe o arcane_explosion Fluffy_Pillow 27874.1/63371: 44% mana arcane_charge(2), thrill_seeker(34)
3:44.417 aoe o arcane_explosion Fluffy_Pillow 24529.3/63371: 39% mana arcane_charge(3), thrill_seeker(35)
3:45.724 aoe p arcane_barrage Fluffy_Pillow 21185.9/63371: 33% mana arcane_charge(4), thrill_seeker(35)
3:47.031 aoe o arcane_explosion Fluffy_Pillow 25377.3/63371: 40% mana thrill_seeker(36)
3:48.338 aoe o arcane_explosion Fluffy_Pillow 22033.8/63371: 35% mana arcane_charge, clearcasting, thrill_seeker(37)
3:49.645 aoe o arcane_explosion Fluffy_Pillow 23690.3/63371: 37% mana arcane_charge(2), thrill_seeker(37)
3:50.952 aoe o arcane_explosion Fluffy_Pillow 20346.8/63371: 32% mana arcane_charge(3), clearcasting, thrill_seeker(38)
3:52.257 aoe p arcane_barrage Fluffy_Pillow 22000.8/63371: 35% mana arcane_charge(4), thrill_seeker(39)
3:53.563 aoe n arcane_orb Fluffy_Pillow 26191.0/63371: 41% mana thrill_seeker(39)
3:54.869 aoe p arcane_barrage Fluffy_Pillow 27346.2/63371: 43% mana arcane_charge(4), euphoria
3:55.959 aoe o arcane_explosion Fluffy_Pillow 31262.6/63371: 49% mana euphoria
3:57.048 aoe o arcane_explosion Fluffy_Pillow 27642.8/63371: 44% mana arcane_charge, thrill_seeker, euphoria
3:58.137 aoe o arcane_explosion Fluffy_Pillow 24023.0/63371: 38% mana arcane_charge(2), thrill_seeker(3), euphoria
3:59.226 aoe o arcane_explosion Fluffy_Pillow 20403.3/63371: 32% mana arcane_charge(3), thrill_seeker(3), euphoria
4:00.314 aoe p arcane_barrage Fluffy_Pillow 16782.2/63371: 26% mana arcane_charge(4), thrill_seeker(4), euphoria
4:01.404 aoe o arcane_explosion Fluffy_Pillow 20698.6/63371: 33% mana thrill_seeker(4), euphoria
4:02.495 aoe o arcane_explosion Fluffy_Pillow 17081.3/63371: 27% mana arcane_charge, thrill_seeker(5), euphoria
4:03.582 aoe o arcane_explosion Fluffy_Pillow 13459.0/63371: 21% mana arcane_charge(2), thrill_seeker(5), euphoria
4:04.672 aoe o arcane_explosion Fluffy_Pillow 9840.5/63371: 16% mana arcane_charge(3), thrill_seeker(6)
4:05.979 aoe p arcane_barrage Fluffy_Pillow 6497.1/63371: 10% mana arcane_charge(4), thrill_seeker(6)
4:07.286 aoe o arcane_explosion Fluffy_Pillow 10688.5/63371: 17% mana thrill_seeker(7)
4:08.591 aoe o arcane_explosion Fluffy_Pillow 7342.4/63371: 12% mana arcane_charge, thrill_seeker(8)
4:09.896 aoe q evocation Fluffy_Pillow 3996.4/63371: 6% mana arcane_charge(2), thrill_seeker(8)
4:14.242 aoe j mirrors_of_torment Fluffy_Pillow 57843.6/63371: 91% mana arcane_charge(2), thrill_seeker(11)
4:15.548 aoe k touch_of_the_magi Fluffy_Pillow 57498.9/63371: 91% mana arcane_charge(2), thrill_seeker(11)
4:16.855 aoe l arcane_power Fluffy_Pillow 56655.4/63371: 89% mana arcane_charge(4), thrill_seeker(12)
4:16.855 shared_cds v berserking Fluffy_Pillow 56655.4/63371: 89% mana arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(12)
4:16.855 aoe p arcane_barrage Fluffy_Pillow 56655.4/63371: 89% mana berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(12)
4:18.043 aoe n arcane_orb Fluffy_Pillow 63230.9/63371: 100% mana berserking, arcane_power, rune_of_power, thrill_seeker(13)
4:19.231 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(13)
4:20.419 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana berserking, arcane_power, rune_of_power, thrill_seeker(14)
4:21.605 aoe o arcane_explosion Fluffy_Pillow 62374.6/63371: 98% mana berserking, arcane_charge, arcane_power, rune_of_power, thrill_seeker(14)
4:22.794 aoe o arcane_explosion Fluffy_Pillow 61381.6/63371: 97% mana berserking, arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(15)
4:23.984 aoe o arcane_explosion Fluffy_Pillow 62924.7/63371: 99% mana berserking, arcane_charge(3), arcane_power, clearcasting, rune_of_power, thrill_seeker(15)
4:25.172 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana berserking, arcane_charge(4), arcane_power, rune_of_power, thrill_seeker(16)
4:26.359 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana berserking, arcane_power, rune_of_power, thrill_seeker(17)
4:27.546 aoe o arcane_explosion Fluffy_Pillow 62375.9/63371: 98% mana berserking, arcane_charge, arcane_power, rune_of_power, thrill_seeker(17)
4:28.736 aoe o arcane_explosion Fluffy_Pillow 61384.1/63371: 97% mana berserking, arcane_charge(2), arcane_power, rune_of_power, thrill_seeker(18)
4:29.925 aoe o arcane_explosion Fluffy_Pillow 62925.9/63371: 99% mana arcane_charge(3), arcane_power, thrill_seeker(18)
4:31.232 aoe m rune_of_power Fluffy_Pillow 62082.5/63371: 98% mana arcane_charge(4), arcane_power, thrill_seeker(19)
4:32.537 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge(4), rune_of_power, thrill_seeker(20)
4:33.843 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana rune_of_power, thrill_seeker(20)
4:35.149 aoe o arcane_explosion Fluffy_Pillow 60026.7/63371: 95% mana arcane_charge, rune_of_power, thrill_seeker(21)
4:36.456 aoe o arcane_explosion Fluffy_Pillow 56683.2/63371: 89% mana arcane_charge(2), rune_of_power, thrill_seeker(22)
4:37.761 aoe o arcane_explosion Fluffy_Pillow 53337.2/63371: 84% mana arcane_charge(3), rune_of_power, thrill_seeker(22)
4:39.067 shared_cds t use_mana_gem Venthyr_Nadjia 49992.5/63371: 79% mana arcane_charge(4), clearcasting, rune_of_power, thrill_seeker(23)
4:39.067 aoe p arcane_barrage Fluffy_Pillow 56329.6/63371: 89% mana arcane_charge(4), clearcasting, rune_of_power, thrill_seeker(23)
4:40.374 aoe n arcane_orb Fluffy_Pillow 60521.0/63371: 96% mana clearcasting, rune_of_power, thrill_seeker(24)
4:41.680 aoe p arcane_barrage Fluffy_Pillow 61676.3/63371: 97% mana arcane_charge(4), clearcasting, rune_of_power, thrill_seeker(24)
4:42.986 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana clearcasting, rune_of_power, thrill_seeker(25)

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Venthyr_Nadjia"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=venthyr
soulbind=331586//arcane_prodigy:6//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Venthyr_Theotar : 16583 dps, 4654 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
16582.6 16582.6 26.5 / 0.160% 1692.5 / 10.2% 8.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
2048.6 1961.9 Mana 0.00% 49.5 100.0% 100%
Talents
Venthyr

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Venthyr_Theotar 16583
Arcane Barrage 5706 34.4% 57.1 5.26sec 30047 24079 Direct 285.3 5044 10109 6020 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.14 285.29 0.00 0.00 1.2479 0.0000 1716731.67 1716731.67 0.00% 24078.93 24078.93
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.73% 230.33 172 286 5043.83 2082 26974 5036.63 4493 5627 1161475 1161475 0.00%
crit 19.27% 54.96 29 83 10109.00 4164 53948 10093.06 7286 14127 555257 555257 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [p]:57.14
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 456 2.7% 43.2 6.52sec 3172 0 Direct 215.8 532 1062 634 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 43.17 215.84 0.00 0.00 0.0000 0.0000 136922.81 136922.81 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.66% 174.11 124 217 531.90 316 664 531.22 498 571 92588 92588 0.00%
crit 19.34% 41.73 22 63 1062.37 633 1329 1061.20 937 1193 44335 44335 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 7741 46.7% 153.9 1.92sec 15113 12164 Direct 769.7 2535 5069 3023 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 153.93 769.66 0.00 0.00 1.2424 0.0000 2326321.09 2326321.09 0.00% 12164.34 12164.34
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 621.28 478 763 2534.59 1958 4616 2534.47 2437 2667 1574461 1574461 0.00%
crit 19.28% 148.38 98 210 5068.74 3916 9232 5067.97 4644 5502 751860 751860 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [o]:153.93
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1397) 0.0% (8.4%) 13.2 23.50sec 31916 25595

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.16 0.00 0.00 0.00 1.2470 0.0000 0.00 0.00 0.00% 25595.36 25595.36

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [n]:13.15
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1397 8.4% 65.7 23.50sec 6394 0 Direct 65.7 5358 10740 6394 19.3%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 65.67 65.67 0.00 0.00 0.0000 0.0000 419891.95 419891.95 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.75% 53.02 37 72 5358.31 3869 9122 5356.18 4800 5905 284116 284116 0.00%
crit 19.25% 12.64 4 24 10740.04 7739 18245 10742.76 7739 13675 135776 135776 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (69) 0.0% (0.4%) 14.7 1.76sec 1386 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.70 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 69 0.4% 14.7 1.76sec 1386 0 Direct 14.7 1164 2327 1386 19.1%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.70 14.70 0.00 0.00 0.0000 0.0000 20374.37 20374.37 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.87% 11.89 5 19 1163.53 1164 1164 1163.53 1164 1164 13832 13832 0.00%
crit 19.13% 2.81 0 10 2327.06 2327 2327 2226.48 0 2327 6542 6542 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1780 20.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1781.76 1781.76 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 79.67% 0.80 0 1 1480.68 1481 1481 1179.60 0 1481 1180 1180 0.00%
crit 20.33% 0.20 0 1 2961.35 2961 2961 602.16 0 2961 602 602 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.1%) 1.0 0.00sec 5787 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 145  / 20 0.1% 90.0 1.29sec 64 49 Direct 90.0 54 108 64 19.2%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5787.20 5787.20 0.00% 49.14 49.14
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.75% 72.68 61 84 53.94 43 60 53.94 52 56 3920 3920 0.00%
crit 19.25% 17.32 6 29 107.77 86 120 107.81 89 120 1867 1867 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Mirrors of Torment 0 (130) 0.0% (0.8%) 2.7 137.70sec 14461 11070

Stats Details: Mirrors Of Torment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.70 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 11070.29 11070.29

Action Details: Mirrors Of Torment

  • id:314793
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • school:shadow
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by {$320035s3=15}%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].

Action Priority List

    aoe
    [j]:2.71
  • if_expr:(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
    Agonizing Backlash 64 0.4% 5.3 55.01sec 3618 0 Direct 5.3 3039 6057 3620 19.2%

Stats Details: Agonizing Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.33 5.33 0.00 0.00 0.0000 0.0000 19290.03 19290.03 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.80% 4.31 1 6 3039.17 1739 3651 3025.17 1739 3651 13097 13097 0.00%
crit 19.20% 1.02 0 5 6057.09 3477 7302 4028.22 0 7302 6193 6193 0.00%

Action Details: Agonizing Backlash

  • id:320035
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:320035
  • name:Agonizing Backlash
  • school:shadow
  • tooltip:Movement speed and cast speed slowed by {$s3=15}%.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
    Tormenting Backlash 66 0.4% 2.6 138.98sec 7642 0 Direct 2.6 6390 12786 7645 19.6%

Stats Details: Tormenting Backlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.59 2.59 0.00 0.00 0.0000 0.0000 19788.09 19788.09 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.42% 2.08 0 3 6390.26 6126 6563 6303.55 0 6563 13308 13308 0.00%
crit 19.58% 0.51 0 3 12786.13 12251 13126 5661.93 0 13126 6480 6480 0.00%

Action Details: Tormenting Backlash

  • id:317589
  • school:shadow
  • range:50000.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.510000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:317589
  • name:Tormenting Backlash
  • school:shadow
  • tooltip:Rooted and Silenced.
  • description:{$@spelldesc314793=Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict {$320035s1=0} Shadow damage and their movement and cast speed are slowed by {$320035s3=15}%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict {$317589s1=0} Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain {$345417s1=4}% mana][]$?c2[your Fire Blast cooldown is reduced by {$s2=4} sec][]$?c3[you gain Brain Freeze][].}
Touch of the Magi 0 (1058) 0.0% (6.4%) 6.1 52.87sec 51981 41344

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.11 0.00 0.00 0.00 1.2574 0.0000 0.00 0.00 0.00% 41343.79 41343.79

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [k]:6.12
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 1058 6.4% 6.1 52.78sec 51981 0 Direct 30.5 10417 0 10417 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.11 30.51 0.00 0.00 0.0000 0.0000 317603.03 317603.03 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 30.51 25 35 10416.81 313 55203 10421.46 5887 13522 317603 317603 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:38826.25
  • base_dd_max:38826.25
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
Venthyr_Theotar
Arcane Power 2.8 129.29sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.83 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [l]:2.83
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.8 258.61sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.83 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [t]:1.83
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 0.8 167.79sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.82 0.00 4.86 0.00 4.3013 0.7220 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [q]:0.82
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [s]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.0 50.93sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 5.98 0.00 0.00 0.00 1.2563 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [m]:6.00
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.66sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.73 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Venthyr_Theotar
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [r]:2.73
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 57.9 181.0 5.2sec 1.2sec 3.8sec 72.85% 0.00% 26.7 (26.8) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 13.5s
  • trigger_min/max:0.0s / 8.3s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.6s

Stack Uptimes

  • arcane_charge_1:18.61%
  • arcane_charge_2:16.32%
  • arcane_charge_3:16.42%
  • arcane_charge_4:21.50%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.8 0.0 129.2sec 129.2sec 14.7sec 13.81% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:121.7s / 135.2s
  • trigger_min/max:121.7s / 135.2s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 15.0s

Stack Uptimes

  • arcane_power_1:13.81%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.8 0.0 258.4sec 258.4sec 11.7sec 7.06% 23.56% 0.0 (0.0) 1.7

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:246.2s / 264.3s
  • trigger_min/max:246.2s / 264.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • berserking_1:7.06%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.5 0.2 11.8sec 11.8sec 2.0sec 16.26% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:16.06%
  • clearcasting_2:0.21%
  • clearcasting_3:0.02%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 0.8 0.0 173.1sec 173.1sec 4.3sec 1.17% 0.00% 3.2 (3.2) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:111.5s / 259.1s
  • trigger_min/max:111.5s / 259.1s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:1.17%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.43% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.43%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.8 0.0 35.4sec 35.4sec 11.8sec 34.57% 0.00% 0.0 (0.0) 8.5

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.1s / 56.6s
  • trigger_min/max:13.1s / 56.6s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:34.57%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Soothing Shade 4.2 0.0 62.8sec 62.8sec 11.8sec 16.31% 0.00% 0.0 (0.0) 4.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_soothing_shade
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stat Details

  • stat:mastery_rating
  • amount:525.00

Trigger Details

  • interval_min/max:20.0s / 203.0s
  • trigger_min/max:20.0s / 203.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 12.0s

Stack Uptimes

  • soothing_shade_1:16.31%

Spelldata

  • id:336885
  • name:Soothing Shade
  • tooltip:Standing in the shade makes it easier to focus, increasing your Mastery by $w1.
  • description:{$@spelldesc336239=Your spells and abilities have a chance to call Tubbins and Gubbins to your side for {$336808d=12 seconds}, parasol in hand. Standing in the shaded area grants you {$336885s1=525} Mastery.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.79% 0.82% 7.04% 0.9s 0.0s 4.8s
Conserve Phase 100.00% 100.00% 100.00% 300.7s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.660120.091239.937
Evocation180.00321.472352.301242.153132.000359.109
Rune of Power6.8721.14224.68842.38526.62855.243
Touch of the Magi5.6830.00020.79536.19625.32053.936
Arcane Power6.7531.67015.18819.5644.02826.641
Arcane Barrage2.7650.0038.281159.034124.778192.002
Arcane Orb3.4750.00011.19946.10935.05059.619
Mirrors of Torment29.5880.00074.72385.60758.461137.748

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
Venthyr_Theotar
mana_regen Mana 521.55 375988.63 63.75% 720.90 13218.53 3.40%
Evocation Mana 38.92 39626.98 6.72% 1018.10 0.00 0.00%
Mana Gem Mana 2.73 17630.66 2.99% 6448.57 0.00 0.00%
Arcane Barrage Mana 57.14 140350.88 23.80% 2456.42 7744.62 5.23%
Mirrors of Torment Mana 7.92 16224.82 2.75% 2049.16 4293.39 20.92%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1961.93 2048.57 25235.7 36696.7 269.2 63371.4
Usage Type Count Total Avg RPE APR
Venthyr_Theotar
arcane_explosion Mana 153.9 588278.5 3821.7 3821.7 4.0
arcane_orb Mana 13.2 5907.2 449.1 449.0 71.1
mirrors_of_torment Mana 2.7 5400.4 2000.0 1998.4 7.2
touch_of_the_magi Mana 6.1 15270.8 2500.0 2499.3 20.8

Statistics & Data Analysis

Fight Length
Venthyr_Theotar Fight Length
Count 1018
Mean 300.66
Minimum 240.09
Maximum 359.94
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
Venthyr_Theotar Damage Per Second
Count 1018
Mean 16582.63
Minimum 15107.80
Maximum 17857.57
Spread ( max - min ) 2749.78
Range [ ( max - min ) / 2 * 100% ] 8.29%
Standard Deviation 430.6337
5th Percentile 15856.24
95th Percentile 17268.37
( 95th Percentile - 5th Percentile ) 1412.14
Mean Distribution
Standard Deviation 13.4969
95.00% Confidence Interval ( 16556.18 - 16609.09 )
Normalized 95.00% Confidence Interval ( 99.84% - 100.16% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 26
0.1% Error 2591
0.1 Scale Factor Error with Delta=300 1584
0.05 Scale Factor Error with Delta=300 6333
0.01 Scale Factor Error with Delta=300 158307
Priority Target DPS
Venthyr_Theotar Priority Target Damage Per Second
Count 1018
Mean 4653.52
Minimum 4118.88
Maximum 5261.58
Spread ( max - min ) 1142.70
Range [ ( max - min ) / 2 * 100% ] 12.28%
Standard Deviation 186.7533
5th Percentile 4357.68
95th Percentile 4971.94
( 95th Percentile - 5th Percentile ) 614.26
Mean Distribution
Standard Deviation 5.8532
95.00% Confidence Interval ( 4642.05 - 4664.99 )
Normalized 95.00% Confidence Interval ( 99.75% - 100.25% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 62
0.1% Error 6187
0.1 Scale Factor Error with Delta=300 298
0.05 Scale Factor Error with Delta=300 1191
0.01 Scale Factor Error with Delta=300 29773
DPS(e)
Venthyr_Theotar Damage Per Second (Effective)
Count 1018
Mean 16582.63
Minimum 15107.80
Maximum 17857.57
Spread ( max - min ) 2749.78
Range [ ( max - min ) / 2 * 100% ] 8.29%
Damage
Venthyr_Theotar Damage
Count 1018
Mean 4978704.80
Minimum 3838639.29
Maximum 6005073.19
Spread ( max - min ) 2166433.91
Range [ ( max - min ) / 2 * 100% ] 21.76%
DTPS
Venthyr_Theotar Damage Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Venthyr_Theotar Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Venthyr_Theotar Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Venthyr_Theotar Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Venthyr_Theotar Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Venthyr_Theotar Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Venthyr_TheotarTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Venthyr_Theotar Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
j 2.71 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
k 6.12 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
l 2.83 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
m 6.00 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
n 13.15 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
o 153.93 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
p 57.14 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
q 0.82 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
r 2.73 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
s 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
t 1.83 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjklstpnpoooopoooopoooompoooropnpoooopoooopoooopoooopnpoooopoooopkmpoooopnpoooopoooopoooopnpoooopoooopkmpoooopnpoooolpoooopoooropnpoooopoooopjkmpnpoooopoooopoooopnpoooopoooopoooqopkmpnpoooopoooopoooopnpoooopoooopooooprjkltpnpoooopoooomp

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask Venthyr_Theotar 63371.4/63371: 100% mana
Pre precombat R food Venthyr_Theotar 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j mirrors_of_torment Fluffy_Pillow 62371.4/63371: 98% mana
0:01.307 aoe k touch_of_the_magi Fluffy_Pillow 61377.8/63371: 97% mana bloodlust
0:02.313 aoe l arcane_power Fluffy_Pillow 68695.7/72371: 95% mana bloodlust, arcane_charge(4), clearcasting, soothing_shade
0:02.313 shared_cds s potion Fluffy_Pillow 68695.7/72371: 95% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, soothing_shade
0:02.313 shared_cds t berserking Fluffy_Pillow 68695.7/72371: 95% mana bloodlust, arcane_charge(4), arcane_power, clearcasting, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:02.313 aoe p arcane_barrage Fluffy_Pillow 68695.7/72371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:03.229 aoe n arcane_orb Fluffy_Pillow 72371.4/72371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:04.143 aoe p arcane_barrage Fluffy_Pillow 72371.4/72371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, clearcasting, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:05.057 aoe o arcane_explosion Fluffy_Pillow 72371.4/72371: 100% mana bloodlust, berserking, arcane_power, clearcasting, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:05.972 aoe o arcane_explosion Fluffy_Pillow 72371.4/72371: 100% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:06.886 aoe o arcane_explosion Fluffy_Pillow 71194.4/72371: 98% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:07.800 aoe o arcane_explosion Fluffy_Pillow 70017.3/72371: 97% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:08.715 aoe p arcane_barrage Fluffy_Pillow 68841.7/72371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:09.628 aoe o arcane_explosion Fluffy_Pillow 72371.4/72371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:10.543 aoe o arcane_explosion Fluffy_Pillow 71195.8/72371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:11.458 aoe o arcane_explosion Fluffy_Pillow 70020.2/72371: 97% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:12.373 aoe o arcane_explosion Fluffy_Pillow 68844.6/72371: 95% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:13.287 aoe p arcane_barrage Fluffy_Pillow 67667.6/72371: 94% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:14.200 aoe o arcane_explosion Fluffy_Pillow 71883.9/72371: 99% mana bloodlust, berserking, arcane_power, rune_of_power, soothing_shade, potion_of_deathly_fixation
0:15.114 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge, arcane_power, clearcasting, potion_of_deathly_fixation
0:16.121 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, arcane_charge(2), arcane_power, potion_of_deathly_fixation
0:17.127 aoe o arcane_explosion Fluffy_Pillow 62146.5/63371: 98% mana bloodlust, arcane_charge(3), arcane_power, potion_of_deathly_fixation
0:18.133 aoe m rune_of_power Fluffy_Pillow 60921.5/63371: 96% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:19.138 aoe p arcane_barrage Fluffy_Pillow 62195.3/63371: 98% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:20.146 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:21.152 aoe o arcane_explosion Fluffy_Pillow 59646.5/63371: 94% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:22.159 aoe o arcane_explosion Fluffy_Pillow 55922.8/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:23.165 shared_cds r use_mana_gem Venthyr_Theotar 52197.8/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.165 aoe o arcane_explosion Fluffy_Pillow 58534.9/63371: 92% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:24.170 aoe p arcane_barrage Fluffy_Pillow 54808.7/63371: 86% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:25.178 aoe n arcane_orb Fluffy_Pillow 58621.1/63371: 93% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:26.186 aoe p arcane_barrage Fluffy_Pillow 59398.7/63371: 94% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:27.192 aoe o arcane_explosion Fluffy_Pillow 63208.6/63371: 100% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:28.199 aoe o arcane_explosion Fluffy_Pillow 59484.9/63371: 94% mana bloodlust, arcane_charge, rune_of_power
0:29.207 aoe o arcane_explosion Fluffy_Pillow 55762.5/63371: 88% mana bloodlust, arcane_charge(2), rune_of_power
0:30.214 aoe o arcane_explosion Fluffy_Pillow 52038.8/63371: 82% mana bloodlust, arcane_charge(3), rune_of_power
0:31.221 aoe p arcane_barrage Fluffy_Pillow 48315.1/63371: 76% mana bloodlust, arcane_charge(4), clearcasting
0:32.228 aoe o arcane_explosion Fluffy_Pillow 52126.2/63371: 82% mana bloodlust, clearcasting
0:33.233 aoe o arcane_explosion Fluffy_Pillow 53400.0/63371: 84% mana bloodlust, arcane_charge
0:34.239 aoe o arcane_explosion Fluffy_Pillow 49675.0/63371: 78% mana bloodlust, arcane_charge(2)
0:35.246 aoe o arcane_explosion Fluffy_Pillow 45951.3/63371: 73% mana bloodlust, arcane_charge(3), clearcasting
0:36.255 aoe p arcane_barrage Fluffy_Pillow 47230.1/63371: 75% mana bloodlust, arcane_charge(4)
0:37.262 aoe o arcane_explosion Fluffy_Pillow 51041.3/63371: 81% mana bloodlust
0:38.268 aoe o arcane_explosion Fluffy_Pillow 47316.3/63371: 75% mana bloodlust, arcane_charge, clearcasting
0:39.275 aoe o arcane_explosion Fluffy_Pillow 48592.6/63371: 77% mana bloodlust, arcane_charge(2)
0:40.282 aoe o arcane_explosion Fluffy_Pillow 44868.9/63371: 71% mana bloodlust, arcane_charge(3)
0:41.289 aoe p arcane_barrage Fluffy_Pillow 41145.2/63371: 65% mana arcane_charge(4), clearcasting
0:42.595 aoe o arcane_explosion Fluffy_Pillow 45335.4/63371: 72% mana clearcasting
0:43.901 aoe o arcane_explosion Fluffy_Pillow 46990.6/63371: 74% mana arcane_charge
0:45.206 aoe o arcane_explosion Fluffy_Pillow 43644.6/63371: 69% mana arcane_charge(2), clearcasting
0:46.513 aoe o arcane_explosion Fluffy_Pillow 45301.1/63371: 71% mana arcane_charge(3)
0:47.820 aoe p arcane_barrage Fluffy_Pillow 41957.7/63371: 66% mana arcane_charge(4)
0:49.127 aoe n arcane_orb Fluffy_Pillow 46149.1/63371: 73% mana
0:50.434 aoe p arcane_barrage Fluffy_Pillow 47305.6/63371: 75% mana arcane_charge(4)
0:51.742 aoe o arcane_explosion Fluffy_Pillow 51498.2/63371: 81% mana
0:53.047 aoe o arcane_explosion Fluffy_Pillow 48152.2/63371: 76% mana arcane_charge
0:54.352 aoe o arcane_explosion Fluffy_Pillow 44806.2/63371: 71% mana arcane_charge(2)
0:55.660 aoe o arcane_explosion Fluffy_Pillow 41464.0/63371: 65% mana arcane_charge(3)
0:56.968 aoe p arcane_barrage Fluffy_Pillow 38121.8/63371: 60% mana arcane_charge(4), clearcasting
0:58.276 aoe o arcane_explosion Fluffy_Pillow 42314.5/63371: 67% mana clearcasting
0:59.583 aoe o arcane_explosion Fluffy_Pillow 43971.0/63371: 69% mana arcane_charge
1:00.890 aoe o arcane_explosion Fluffy_Pillow 40627.5/63371: 64% mana arcane_charge(2)
1:02.195 aoe o arcane_explosion Fluffy_Pillow 37281.5/63371: 59% mana arcane_charge(3)
1:03.501 aoe p arcane_barrage Fluffy_Pillow 33936.8/63371: 54% mana arcane_charge(4)
1:04.807 aoe k touch_of_the_magi Fluffy_Pillow 38126.9/63371: 60% mana
1:06.114 aoe m rune_of_power Fluffy_Pillow 37283.4/63371: 59% mana arcane_charge(4)
1:07.419 aoe p arcane_barrage Fluffy_Pillow 38937.4/63371: 61% mana arcane_charge(4), rune_of_power
1:08.724 aoe o arcane_explosion Fluffy_Pillow 43126.3/63371: 68% mana rune_of_power
1:10.029 aoe o arcane_explosion Fluffy_Pillow 39780.3/63371: 63% mana arcane_charge, rune_of_power
1:11.336 aoe o arcane_explosion Fluffy_Pillow 36436.8/63371: 57% mana arcane_charge(2), rune_of_power
1:12.642 aoe o arcane_explosion Fluffy_Pillow 33092.1/63371: 52% mana arcane_charge(3), rune_of_power
1:13.947 aoe p arcane_barrage Fluffy_Pillow 29746.1/63371: 47% mana arcane_charge(4), rune_of_power
1:15.254 aoe n arcane_orb Fluffy_Pillow 33937.5/63371: 54% mana rune_of_power
1:16.560 aoe p arcane_barrage Fluffy_Pillow 35092.7/63371: 55% mana arcane_charge(4), rune_of_power
1:17.867 aoe o arcane_explosion Fluffy_Pillow 39284.1/63371: 62% mana rune_of_power
1:19.174 aoe o arcane_explosion Fluffy_Pillow 35940.6/63371: 57% mana arcane_charge, rune_of_power
1:20.482 aoe o arcane_explosion Fluffy_Pillow 37228.1/72371: 51% mana arcane_charge(2), soothing_shade
1:21.788 aoe o arcane_explosion Fluffy_Pillow 34118.4/72371: 47% mana arcane_charge(3), soothing_shade
1:23.095 aoe p arcane_barrage Fluffy_Pillow 31010.2/72371: 43% mana arcane_charge(4), clearcasting, soothing_shade
1:24.403 aoe o arcane_explosion Fluffy_Pillow 35798.3/72371: 49% mana clearcasting, soothing_shade
1:25.710 aoe o arcane_explosion Fluffy_Pillow 37690.1/72371: 52% mana arcane_charge, soothing_shade
1:27.016 aoe o arcane_explosion Fluffy_Pillow 34580.4/72371: 48% mana arcane_charge(2), soothing_shade
1:28.323 aoe o arcane_explosion Fluffy_Pillow 31472.2/72371: 43% mana arcane_charge(3), soothing_shade
1:29.629 aoe p arcane_barrage Fluffy_Pillow 28362.5/72371: 39% mana arcane_charge(4), soothing_shade
1:30.934 aoe o arcane_explosion Fluffy_Pillow 33146.3/72371: 46% mana soothing_shade
1:32.242 aoe o arcane_explosion Fluffy_Pillow 26303.9/63371: 42% mana arcane_charge
1:33.548 aoe o arcane_explosion Fluffy_Pillow 22959.1/63371: 36% mana arcane_charge(2)
1:34.856 aoe o arcane_explosion Fluffy_Pillow 19616.9/63371: 31% mana arcane_charge(3), clearcasting
1:36.163 aoe p arcane_barrage Fluffy_Pillow 21273.4/63371: 34% mana arcane_charge(4)
1:37.471 aoe n arcane_orb Fluffy_Pillow 25466.1/63371: 40% mana
1:38.777 aoe p arcane_barrage Fluffy_Pillow 26621.4/63371: 42% mana arcane_charge(4)
1:40.082 aoe o arcane_explosion Fluffy_Pillow 30810.2/63371: 49% mana
1:41.388 aoe o arcane_explosion Fluffy_Pillow 27465.5/63371: 43% mana arcane_charge
1:42.694 aoe o arcane_explosion Fluffy_Pillow 24120.7/63371: 38% mana arcane_charge(2)
1:44.001 aoe o arcane_explosion Fluffy_Pillow 20777.3/63371: 33% mana arcane_charge(3)
1:45.309 aoe p arcane_barrage Fluffy_Pillow 17435.1/63371: 28% mana arcane_charge(4)
1:46.615 aoe o arcane_explosion Fluffy_Pillow 21625.2/63371: 34% mana
1:47.922 aoe o arcane_explosion Fluffy_Pillow 18281.7/63371: 29% mana arcane_charge
1:49.230 aoe o arcane_explosion Fluffy_Pillow 14939.5/63371: 24% mana arcane_charge(2), clearcasting
1:50.537 aoe o arcane_explosion Fluffy_Pillow 16596.0/63371: 26% mana arcane_charge(3)
1:51.845 aoe p arcane_barrage Fluffy_Pillow 13253.8/63371: 21% mana arcane_charge(4)
1:53.152 aoe k touch_of_the_magi Fluffy_Pillow 17445.2/63371: 28% mana
1:54.459 aoe m rune_of_power Fluffy_Pillow 16601.7/63371: 26% mana arcane_charge(4)
1:55.765 aoe p arcane_barrage Fluffy_Pillow 18257.0/63371: 29% mana arcane_charge(4), rune_of_power
1:57.071 aoe o arcane_explosion Fluffy_Pillow 22447.1/63371: 35% mana rune_of_power
1:58.379 aoe o arcane_explosion Fluffy_Pillow 21818.2/72371: 30% mana arcane_charge, rune_of_power, soothing_shade
1:59.685 aoe o arcane_explosion Fluffy_Pillow 18708.5/72371: 26% mana arcane_charge(2), rune_of_power, soothing_shade
2:00.994 aoe o arcane_explosion Fluffy_Pillow 15603.2/72371: 22% mana arcane_charge(3), rune_of_power, soothing_shade
2:02.301 aoe p arcane_barrage Fluffy_Pillow 12495.0/72371: 17% mana arcane_charge(4), rune_of_power, soothing_shade
2:03.608 aoe n arcane_orb Fluffy_Pillow 17281.7/72371: 24% mana rune_of_power, soothing_shade
2:04.915 aoe p arcane_barrage Fluffy_Pillow 18673.5/72371: 26% mana arcane_charge(4), rune_of_power, soothing_shade
2:06.222 aoe o arcane_explosion Fluffy_Pillow 23460.1/72371: 32% mana rune_of_power, soothing_shade
2:07.528 aoe o arcane_explosion Fluffy_Pillow 20350.4/72371: 28% mana arcane_charge, rune_of_power, soothing_shade
2:08.833 aoe o arcane_explosion Fluffy_Pillow 17239.3/72371: 24% mana arcane_charge(2), soothing_shade
2:10.139 aoe o arcane_explosion Fluffy_Pillow 12372.5/63371: 20% mana arcane_charge(3)
2:11.446 aoe l arcane_power Fluffy_Pillow 9029.1/63371: 14% mana arcane_charge(4)
2:11.446 aoe p arcane_barrage Fluffy_Pillow 9029.1/63371: 14% mana arcane_charge(4), arcane_power, rune_of_power
2:12.751 aoe o arcane_explosion Fluffy_Pillow 13217.9/63371: 21% mana arcane_power, rune_of_power
2:14.057 aoe o arcane_explosion Fluffy_Pillow 12373.2/63371: 20% mana arcane_charge, arcane_power, rune_of_power
2:15.362 aoe o arcane_explosion Fluffy_Pillow 11527.2/63371: 18% mana arcane_charge(2), arcane_power, rune_of_power
2:16.670 aoe o arcane_explosion Fluffy_Pillow 10685.0/63371: 17% mana arcane_charge(3), arcane_power, rune_of_power
2:17.977 aoe p arcane_barrage Fluffy_Pillow 9841.5/63371: 16% mana arcane_charge(4), arcane_power, clearcasting, rune_of_power
2:19.284 aoe o arcane_explosion Fluffy_Pillow 14032.9/63371: 22% mana arcane_power, clearcasting, rune_of_power
2:20.589 aoe o arcane_explosion Fluffy_Pillow 15686.9/63371: 25% mana arcane_charge, arcane_power, rune_of_power
2:21.895 aoe o arcane_explosion Fluffy_Pillow 14842.1/63371: 23% mana arcane_charge(2), arcane_power, rune_of_power
2:23.204 shared_cds r use_mana_gem Venthyr_Theotar 14001.2/63371: 22% mana arcane_charge(3), arcane_power, rune_of_power
2:23.204 aoe o arcane_explosion Fluffy_Pillow 20338.3/63371: 32% mana arcane_charge(3), arcane_power, rune_of_power
2:24.510 aoe p arcane_barrage Fluffy_Pillow 19493.6/63371: 31% mana arcane_charge(4), arcane_power
2:25.817 aoe n arcane_orb Fluffy_Pillow 23685.0/63371: 37% mana arcane_power
2:27.122 aoe p arcane_barrage Fluffy_Pillow 25089.0/63371: 40% mana arcane_charge(4)
2:28.429 aoe o arcane_explosion Fluffy_Pillow 29280.4/63371: 46% mana
2:29.736 aoe o arcane_explosion Fluffy_Pillow 25936.9/63371: 41% mana arcane_charge
2:31.042 aoe o arcane_explosion Fluffy_Pillow 22592.2/63371: 36% mana arcane_charge(2)
2:32.347 aoe o arcane_explosion Fluffy_Pillow 19246.2/63371: 30% mana arcane_charge(3)
2:33.653 aoe p arcane_barrage Fluffy_Pillow 15901.4/63371: 25% mana arcane_charge(4)
2:34.960 aoe o arcane_explosion Fluffy_Pillow 20092.8/63371: 32% mana
2:36.266 aoe o arcane_explosion Fluffy_Pillow 16748.1/63371: 26% mana arcane_charge
2:37.574 aoe o arcane_explosion Fluffy_Pillow 13405.9/63371: 21% mana arcane_charge(2), clearcasting
2:38.881 aoe o arcane_explosion Fluffy_Pillow 15062.4/63371: 24% mana arcane_charge(3)
2:40.187 aoe p arcane_barrage Fluffy_Pillow 11717.7/63371: 18% mana arcane_charge(4)
2:41.494 aoe j mirrors_of_torment Fluffy_Pillow 15909.0/63371: 25% mana
2:42.802 aoe k touch_of_the_magi Fluffy_Pillow 15566.8/63371: 25% mana
2:44.107 aoe m rune_of_power Fluffy_Pillow 14720.8/63371: 23% mana arcane_charge(4)
2:45.413 aoe p arcane_barrage Fluffy_Pillow 18910.9/63371: 30% mana arcane_charge(4), rune_of_power
2:46.720 aoe n arcane_orb Fluffy_Pillow 23102.3/63371: 36% mana rune_of_power
2:48.027 aoe p arcane_barrage Fluffy_Pillow 24258.9/63371: 38% mana arcane_charge(4), rune_of_power
2:49.333 aoe o arcane_explosion Fluffy_Pillow 28449.0/63371: 45% mana rune_of_power
2:50.641 aoe o arcane_explosion Fluffy_Pillow 27641.6/63371: 44% mana arcane_charge, rune_of_power
2:51.947 aoe o arcane_explosion Fluffy_Pillow 24296.9/63371: 38% mana arcane_charge(2), rune_of_power
2:53.254 aoe o arcane_explosion Fluffy_Pillow 20953.4/63371: 33% mana arcane_charge(3), rune_of_power
2:54.562 aoe p arcane_barrage Fluffy_Pillow 17611.2/63371: 28% mana arcane_charge(4), rune_of_power
2:55.871 aoe o arcane_explosion Fluffy_Pillow 21805.1/63371: 34% mana rune_of_power
2:57.178 aoe o arcane_explosion Fluffy_Pillow 20996.5/63371: 33% mana arcane_charge, rune_of_power
2:58.485 aoe o arcane_explosion Fluffy_Pillow 17653.1/63371: 28% mana arcane_charge(2), clearcasting
2:59.792 aoe o arcane_explosion Fluffy_Pillow 19309.6/63371: 30% mana arcane_charge(3)
3:01.098 aoe p arcane_barrage Fluffy_Pillow 15964.9/63371: 25% mana arcane_charge(4), clearcasting
3:02.405 aoe o arcane_explosion Fluffy_Pillow 23018.8/72371: 32% mana clearcasting, soothing_shade
3:03.714 aoe o arcane_explosion Fluffy_Pillow 24913.5/72371: 34% mana arcane_charge, soothing_shade
3:05.021 aoe o arcane_explosion Fluffy_Pillow 21805.3/72371: 30% mana arcane_charge(2), clearcasting, soothing_shade
3:06.327 aoe o arcane_explosion Fluffy_Pillow 23695.6/72371: 33% mana arcane_charge(3), soothing_shade
3:07.634 aoe p arcane_barrage Fluffy_Pillow 20587.4/72371: 28% mana arcane_charge(4), clearcasting, soothing_shade
3:08.942 aoe n arcane_orb Fluffy_Pillow 25375.5/72371: 35% mana clearcasting, soothing_shade
3:10.249 aoe p arcane_barrage Fluffy_Pillow 26767.3/72371: 37% mana arcane_charge(4), clearcasting, soothing_shade
3:11.556 aoe o arcane_explosion Fluffy_Pillow 31554.0/72371: 44% mana clearcasting, soothing_shade
3:12.864 aoe o arcane_explosion Fluffy_Pillow 33447.2/72371: 46% mana arcane_charge, soothing_shade
3:14.170 aoe o arcane_explosion Fluffy_Pillow 26564.8/63371: 42% mana arcane_charge(2)
3:15.477 aoe o arcane_explosion Fluffy_Pillow 23221.3/63371: 37% mana arcane_charge(3)
3:16.784 aoe p arcane_barrage Fluffy_Pillow 19877.9/63371: 31% mana arcane_charge(4)
3:18.089 aoe o arcane_explosion Fluffy_Pillow 24066.7/63371: 38% mana
3:19.396 aoe o arcane_explosion Fluffy_Pillow 20723.2/63371: 33% mana arcane_charge
3:20.703 aoe o arcane_explosion Fluffy_Pillow 17379.8/63371: 27% mana arcane_charge(2)
3:22.009 aoe o arcane_explosion Fluffy_Pillow 14035.0/63371: 22% mana arcane_charge(3)
3:23.315 aoe p arcane_barrage Fluffy_Pillow 10690.3/63371: 17% mana arcane_charge(4)
3:24.622 aoe o arcane_explosion Fluffy_Pillow 14881.7/63371: 23% mana
3:25.930 aoe o arcane_explosion Fluffy_Pillow 11539.5/63371: 18% mana arcane_charge
3:27.235 aoe o arcane_explosion Fluffy_Pillow 8193.5/63371: 13% mana arcane_charge(2)
3:28.542 aoe q evocation Venthyr_Theotar 4850.0/63371: 8% mana arcane_charge(3)
3:32.888 aoe o arcane_explosion Fluffy_Pillow 58697.2/63371: 93% mana arcane_charge(3)
3:34.193 aoe p arcane_barrage Fluffy_Pillow 55351.2/63371: 87% mana arcane_charge(4)
3:35.498 aoe k touch_of_the_magi Fluffy_Pillow 59540.1/63371: 94% mana
3:36.803 aoe m rune_of_power Fluffy_Pillow 58694.0/63371: 93% mana arcane_charge(4), clearcasting
3:38.108 aoe p arcane_barrage Fluffy_Pillow 60348.0/63371: 95% mana arcane_charge(4), clearcasting, rune_of_power
3:39.414 aoe n arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana clearcasting, rune_of_power
3:40.721 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge(4), clearcasting, rune_of_power
3:42.027 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana clearcasting, rune_of_power
3:43.334 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge, rune_of_power
3:44.642 aoe o arcane_explosion Fluffy_Pillow 60029.2/63371: 95% mana arcane_charge(2), rune_of_power
3:45.947 aoe o arcane_explosion Fluffy_Pillow 56683.2/63371: 89% mana arcane_charge(3), rune_of_power
3:47.254 aoe p arcane_barrage Fluffy_Pillow 53339.7/63371: 84% mana arcane_charge(4), clearcasting, rune_of_power
3:48.561 aoe o arcane_explosion Fluffy_Pillow 57531.1/63371: 91% mana clearcasting, rune_of_power
3:49.867 aoe o arcane_explosion Fluffy_Pillow 59186.4/63371: 93% mana arcane_charge, rune_of_power
3:51.174 aoe o arcane_explosion Fluffy_Pillow 55842.9/63371: 88% mana arcane_charge(2)
3:52.479 aoe o arcane_explosion Fluffy_Pillow 52496.9/63371: 83% mana arcane_charge(3)
3:53.785 aoe p arcane_barrage Fluffy_Pillow 49152.2/63371: 78% mana arcane_charge(4)
3:55.091 aoe o arcane_explosion Fluffy_Pillow 53342.3/63371: 84% mana
3:56.396 aoe o arcane_explosion Fluffy_Pillow 49996.3/63371: 79% mana arcane_charge
3:57.702 aoe o arcane_explosion Fluffy_Pillow 46651.6/63371: 74% mana arcane_charge(2)
3:59.009 aoe o arcane_explosion Fluffy_Pillow 43308.1/63371: 68% mana arcane_charge(3), clearcasting
4:00.316 aoe p arcane_barrage Fluffy_Pillow 44964.6/63371: 71% mana arcane_charge(4)
4:01.622 aoe n arcane_orb Fluffy_Pillow 49154.7/63371: 78% mana
4:02.930 aoe p arcane_barrage Fluffy_Pillow 50312.5/63371: 79% mana arcane_charge(4)
4:04.238 aoe o arcane_explosion Fluffy_Pillow 54505.2/63371: 86% mana
4:05.545 aoe o arcane_explosion Fluffy_Pillow 51161.7/63371: 81% mana arcane_charge, clearcasting
4:06.852 aoe o arcane_explosion Fluffy_Pillow 52818.2/63371: 83% mana arcane_charge(2)
4:08.159 aoe o arcane_explosion Fluffy_Pillow 49474.8/63371: 78% mana arcane_charge(3)
4:09.467 aoe p arcane_barrage Fluffy_Pillow 46132.6/63371: 73% mana arcane_charge(4), clearcasting
4:10.772 aoe o arcane_explosion Fluffy_Pillow 50321.4/63371: 79% mana clearcasting
4:12.079 aoe o arcane_explosion Fluffy_Pillow 51977.9/63371: 82% mana arcane_charge
4:13.385 aoe o arcane_explosion Fluffy_Pillow 48633.2/63371: 77% mana arcane_charge(2)
4:14.693 aoe o arcane_explosion Fluffy_Pillow 45291.0/63371: 71% mana arcane_charge(3)
4:15.996 aoe p arcane_barrage Fluffy_Pillow 41942.5/63371: 66% mana arcane_charge(4), clearcasting
4:17.302 aoe o arcane_explosion Fluffy_Pillow 46132.6/63371: 73% mana clearcasting
4:18.609 aoe o arcane_explosion Fluffy_Pillow 47789.1/63371: 75% mana arcane_charge
4:19.916 aoe o arcane_explosion Fluffy_Pillow 44445.6/63371: 70% mana arcane_charge(2)
4:21.221 aoe o arcane_explosion Fluffy_Pillow 41099.6/63371: 65% mana arcane_charge(3), clearcasting
4:22.529 aoe p arcane_barrage Fluffy_Pillow 42757.4/63371: 67% mana arcane_charge(4)
4:23.836 shared_cds r use_mana_gem Venthyr_Theotar 46948.8/63371: 74% mana
4:23.836 aoe j mirrors_of_torment Fluffy_Pillow 53286.0/63371: 84% mana
4:25.143 aoe k touch_of_the_magi Fluffy_Pillow 52942.5/63371: 84% mana
4:26.449 aoe l arcane_power Fluffy_Pillow 52097.8/63371: 82% mana arcane_charge(4)
4:26.449 shared_cds t berserking Fluffy_Pillow 52097.8/63371: 82% mana arcane_charge(4), arcane_power, rune_of_power
4:26.449 aoe p arcane_barrage Fluffy_Pillow 52097.8/63371: 82% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:27.638 aoe n arcane_orb Fluffy_Pillow 58674.4/63371: 93% mana berserking, arcane_power, rune_of_power
4:28.828 aoe p arcane_barrage Fluffy_Pillow 59932.7/63371: 95% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:30.018 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana berserking, arcane_power, rune_of_power
4:31.206 aoe o arcane_explosion Fluffy_Pillow 62377.1/63371: 98% mana berserking, arcane_charge, arcane_power, rune_of_power
4:32.396 aoe o arcane_explosion Fluffy_Pillow 61385.4/63371: 97% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:33.584 aoe o arcane_explosion Fluffy_Pillow 62925.9/63371: 99% mana berserking, arcane_charge(3), arcane_power, rune_of_power
4:34.772 aoe p arcane_barrage Fluffy_Pillow 61931.6/63371: 98% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:35.961 aoe o arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana berserking, arcane_power, rune_of_power
4:37.150 aoe o arcane_explosion Fluffy_Pillow 62378.4/63371: 98% mana berserking, arcane_charge, arcane_power, rune_of_power
4:38.338 aoe o arcane_explosion Fluffy_Pillow 61384.1/63371: 97% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:39.526 aoe o arcane_explosion Fluffy_Pillow 62924.7/63371: 99% mana arcane_charge(3), arcane_power
4:40.832 aoe m rune_of_power Fluffy_Pillow 62079.9/63371: 98% mana arcane_charge(4), arcane_power
4:42.137 aoe p arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana arcane_charge(4), rune_of_power

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="Venthyr_Theotar"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021
covenant=venthyr
soulbind=336239//51:6

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

arcane : 15848 dps, 4332 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
15848.3 15848.3 23.9 / 0.151% 1468.3 / 9.3% 7.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
2049.6 1946.2 Mana 0.00% 49.4 100.0% 100%
Talents

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
arcane 15848
Arcane Barrage 5661 35.7% 57.4 5.26sec 29677 23881 Direct 286.5 4983 9969 5943 19.3%

Stats Details: Arcane Barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 57.37 286.52 0.00 0.00 1.2427 0.0000 1702591.28 1702591.28 0.00% 23880.94 23880.94
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.74% 231.34 177 290 4983.09 2082 25140 4979.76 4476 5449 1152657 1152657 0.00%
crit 19.26% 55.18 26 90 9969.01 4164 50280 9950.92 7006 13825 549935 549935 0.00%

Action Details: Arcane Barrage

  • id:44425
  • school:arcane
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:3.000
  • cooldown hasted:true
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.728000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:44425
  • name:Arcane Barrage
  • school:arcane
  • tooltip:
  • description:Launches bolts of arcane energy at the enemy target, causing {$s1=0 + 72.8%} Arcane damage. For each Arcane Charge, deals {$36032s2=30}% additional damage$?a321526[, grants you {$321526s1=2}% of your maximum mana,][]$?a231564[ and hits {$36032s3=0} additional nearby $Ltarget:targets; for {$s2=40}% of its damage][]. |cFFFFFFFFConsumes all Arcane Charges.|r

Action Priority List

    aoe
    [o]:57.36
  • if_expr:buff.arcane_charge.stack=buff.arcane_charge.max_stack
Arcane Echo 392 2.5% 37.2 7.65sec 3168 0 Direct 185.9 531 1063 634 19.3%

Stats Details: Arcane Echo

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 37.18 185.90 0.00 0.00 0.0000 0.0000 117794.91 117794.91 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.70% 150.03 101 190 531.19 443 664 530.62 498 555 79665 79665 0.00%
crit 19.30% 35.87 17 60 1062.88 886 1329 1062.05 908 1192 38130 38130 0.00%

Action Details: Arcane Echo

  • id:342232
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:8
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.109200
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:342232
  • name:Arcane Echo
  • school:arcane
  • tooltip:
  • description:{$@spelldesc342231=Direct damage you deal to enemies affected by Touch of the Magi, causes an explosion that deals {$342232s1=0 + 10.9%} Arcane damage to {$s1=8} nearby enemies.}
Arcane Explosion 7650 48.3% 155.0 1.91sec 14829 11933 Direct 775.1 2487 4974 2967 19.3%

Stats Details: Arcane Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 155.02 775.12 0.00 0.00 1.2427 0.0000 2298856.34 2298856.34 0.00% 11933.18 11933.18
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.72% 625.68 487 771 2486.89 1958 4112 2486.79 2404 2580 1555792 1555792 0.00%
crit 19.28% 149.43 90 209 4973.51 3916 8223 4973.25 4555 5452 743064 743064 0.00%

Action Details: Arcane Explosion

  • id:1449
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:10.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:5000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.502320
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:1449
  • name:Arcane Explosion
  • school:arcane
  • tooltip:
  • description:Causes an explosion of magic around the caster, dealing {$s2=0 + 50.2%} Arcane damage to all enemies within $A2 yards.$?a137021[ |cFFFFFFFFGenerates {$s1=1} Arcane Charge if any targets are hit.|r][]

Action Priority List

    aoe
    [n]:155.03
  • if_expr:buff.arcane_charge.stack<buff.arcane_charge.max_stack
Arcane Orb 0 (1372) 0.0% (8.6%) 13.2 23.64sec 31329 25123

Stats Details: Arcane Orb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 13.15 0.00 0.00 0.00 1.2471 0.0000 0.00 0.00 0.00% 25122.72 25122.72

Action Details: Arcane Orb

  • id:153626
  • school:arcane
  • range:40.0
  • travel_speed:20.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:20.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:mana
  • base_cost:500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Spelldata

  • id:153626
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r

Action Priority List

    aoe
    [m]:13.15
  • if_expr:buff.arcane_charge.stack=0
    Arcane Orb (_bolt) 1372 8.6% 65.6 23.64sec 6279 0 Direct 65.6 5266 10498 6280 19.4%

Stats Details: Arcane Orb Bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 65.61 65.61 0.00 0.00 0.0000 0.0000 411987.44 411987.44 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.63% 52.90 37 72 5266.34 3869 8126 5267.61 4698 5766 278585 278585 0.00%
crit 19.37% 12.71 4 26 10498.31 7739 16251 10502.59 8020 14446 133403 133403 0.00%

Action Details: Arcane Orb Bolt

  • id:153640
  • school:arcane
  • range:100.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:1.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.092000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:153640
  • name:Arcane Orb
  • school:arcane
  • tooltip:
  • description:{$@spelldesc153626=Launches an Arcane Orb forward from your position, traveling up to 40 yards, dealing {$153640s1=0 + 109.2%} Arcane damage to enemies it passes through. |cFFFFFFFFGrants 1 Arcane Charge when cast and every time it deals damage.|r}
Deathly Fixation 0 (68) 0.0% (0.4%) 14.4 1.73sec 1393 0

Stats Details: Deathly Fixation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.39 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Deathly Fixation

  • id:322253
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:42.90
  • base_td_mult:1.00
  • dot_duration:8.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:322253
  • name:Deathly Fixation
  • school:shadow
  • tooltip:Taking $w1 Shadow damage every $t1.
  • description:Deal {$s1=43} Shadow damage every $t1. Stacks up to 5 times.
    Deathly Eruption 68 0.4% 14.4 1.73sec 1393 0 Direct 14.4 1164 2327 1393 19.8%

Stats Details: Deathly Eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 14.39 14.39 0.00 0.00 0.0000 0.0000 20058.91 20058.91 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.24% 11.55 5 19 1163.53 1164 1164 1163.53 1164 1164 13439 13439 0.00%
crit 19.76% 2.84 0 9 2327.06 2327 2327 2210.48 0 2327 6620 6620 0.00%

Action Details: Deathly Eruption

  • id:322256
  • school:shadow
  • range:40.0
  • travel_speed:0.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:984.99
  • base_dd_max:984.99
  • base_dd_mult:1.00

Spelldata

  • id:322256
  • name:Deathly Eruption
  • school:shadow
  • tooltip:
  • description:Deal {$s1=985} Shadow damage.
Frostbolt 6 0.0% 0.0 0.00sec 0 0 Direct 1.0 1481 2961 1789 21.0%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 0.00 1.00 0.00 0.00 0.0000 0.0000 1791.94 1791.94 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 78.98% 0.79 0 1 1480.68 1481 1481 1169.41 0 1481 1169 1169 0.00%
crit 21.02% 0.21 0 1 2961.35 2961 2961 622.52 0 2961 623 623 0.00%

Action Details: Frostbolt

  • id:116
  • school:frost
  • range:40.0
  • travel_speed:35.0000
  • radius:0.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.511000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:116
  • name:Frostbolt
  • school:frost
  • tooltip:
  • description:Launches a bolt of frost at the enemy, causing {$228597s1=0} Frost damage and slowing movement speed by {$205708s1=50}% for {$205708d=8 seconds}.
Mirror Image 0 (20) 0.0% (0.1%) 1.0 0.00sec 5791 0

Stats Details: Mirror Image

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Mirror Image

  • id:55342
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:1000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:55342
  • name:Mirror Image
  • school:arcane
  • tooltip:Damage taken is reduced by {$s3=20}% while your images are active.
  • description:Creates {$s2=3} copies of you nearby for {$55342d=40 seconds}, which cast spells and attack your enemies. While your images are active damage taken is reduced by {$s3=20}%, taking direct damage will cause one of your images to dissipate.
    Frostbolt (mirror_image) 145  / 20 0.1% 90.0 1.29sec 64 49 Direct 90.0 54 108 64 19.3%

Stats Details: Frostbolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 90.00 90.00 0.00 0.00 1.3087 0.0000 5790.59 5790.59 0.00% 49.16 49.16
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 80.68% 72.61 61 83 53.94 43 60 53.94 53 55 3917 3917 0.00%
crit 19.32% 17.39 7 29 107.77 86 120 107.73 93 118 1874 1874 0.00%

Action Details: Frostbolt

  • id:59638
  • school:frost
  • range:40.0
  • travel_speed:24.0000
  • radius:0.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.027000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:1.00

Spelldata

  • id:59638
  • name:Frostbolt
  • school:frost
  • tooltip:Reduced movement speed.
  • description:Inflicts Frost damage to an enemy and reduces its movement speed for {$d=4 seconds}.

Action Priority List

    default
    [ ]:31.00
Touch of the Magi 0 (680) 0.0% (4.3%) 6.2 52.24sec 32966 25232

Stats Details: Touch Of The Magi

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.19 0.00 0.00 0.00 1.3065 0.0000 0.00 0.00 0.00% 25232.34 25232.34

Action Details: Touch Of The Magi

  • id:321507
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:true

Resources

  • resource:mana
  • base_cost:2500.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:4.0

Spelldata

  • id:321507
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]

Action Priority List

    aoe
    [j]:6.20
  • if_expr:buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
    Touch of the Magi (_explosion) 680 4.3% 6.2 52.13sec 32966 0 Direct 30.9 6608 0 6608 0.0%

Stats Details: Touch Of The Magi Explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.19 30.87 0.00 0.00 0.0000 0.0000 204079.13 204079.13 0.00% 0.00 0.00
Direct Results Count Simulation Iteration Average Amount
Percent Mean Min Max Mean Min Max Mean Min Max Actual Raw Mitigated
hit 100.00% 30.87 25 35 6607.69 1576 36533 6607.10 4548 9024 204079 204079 0.00%

Action Details: Touch Of The Magi Explosion

  • id:210833
  • school:arcane
  • range:40.0
  • travel_speed:0.0000
  • radius:8.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:-1
  • harmful:true

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Direct Damage

  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:20041.85
  • base_dd_max:20041.85
  • base_dd_mult:1.00

Spelldata

  • id:210833
  • name:Touch of the Magi
  • school:arcane
  • tooltip:
  • description:{$@spelldesc321507=Applies Touch of the Magi to your current target, accumulating {$s1=25}% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and reduced damage to all nearby enemies.$?a343215[ |cFFFFFFFFGenerates {$s2=4} Arcane Charges.|r][]}
Simple Action Stats Execute Interval
arcane
Arcane Power 2.9 128.60sec

Stats Details: Arcane Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Arcane Power

  • id:12042
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:12042
  • name:Arcane Power
  • school:arcane
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].

Action Priority List

    aoe
    [k]:2.85
  • if_expr:((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
Berserking 1.9 257.11sec

Stats Details: Berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.85 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Berserking

  • id:26297
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:spell_speed
  • min_gcd:0.0000
  • cooldown:180.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.

Action Priority List

    shared_cds
    [s]:1.85
  • if_expr:buff.arcane_power.up
Conjure Mana Gem 1.0 0.00sec

Stats Details: Conjure Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Conjure Mana Gem

  • id:759
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:mana
  • base_cost:9000.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:759
  • name:Conjure Mana Gem
  • school:arcane
  • tooltip:
  • description:Conjures a Mana Gem that can be used to instantly restore {$5405s1=10}% mana, and holds up to {$s2=3} charges. $@spellname118812 {$@spelldesc118812=Conjured items disappear if logged out for more than 15 minutes.}
Evocation 1.2 172.36sec

Stats Details: Evocation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.21 0.00 7.15 0.00 4.2895 0.7215 0.00 0.00 0.00% 0.00 0.00

Action Details: Evocation

  • id:12051
  • school:arcane
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:90.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Damage Over Time

  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH

Spelldata

  • id:12051
  • name:Evocation
  • school:arcane
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.

Action Priority List

    aoe
    [p]:1.21
  • interrupt_if_expr:mana.pct>=85
Spectral Flask of Power (flask) 1.0 0.00sec

Stats Details: Flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Flask

  • id:307185
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Feast of Gluttonous Hedonism (food) 1.0 0.00sec

Stats Details: Food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Food

  • id:308462
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:0.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0
Potion of Deathly Fixation (potion) 1.0 0.00sec

Stats Details: Potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Potion

  • id:307497
  • school:none
  • range:-1.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:300.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Action Priority List

    shared_cds
    [r]:1.00
  • if_expr:buff.arcane_power.up
Rune of Power 6.1 50.36sec

Stats Details: Rune Of Power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 6.05 0.00 0.00 0.00 1.2569 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Rune Of Power

  • id:116011
  • school:arcane
  • range:30.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:1.5000
  • gcd_type:spell_speed
  • min_gcd:0.7500
  • cooldown:45.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.

Action Priority List

    aoe
    [l]:6.07
  • if_expr:buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
Replenish Mana (use_mana_gem) 2.7 123.31sec

Stats Details: Use Mana Gem

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Raw Amount Mitigated Amount per Total Time Amount per Total Execute Time
damage 2.74 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00% 0.00 0.00

Action Details: Use Mana Gem

  • id:5405
  • school:physical
  • range:0.0
  • travel_speed:0.0000
  • radius:-1.0
  • trigger_gcd:0.0000
  • gcd_type:none
  • min_gcd:0.0000
  • cooldown:120.000
  • cooldown hasted:false
  • base_recharge_multiplier:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:arcane
  • aoe:0
  • harmful:false

Resources

  • resource:none
  • base_cost:0.0
  • secondary_cost:0.0
  • energize_type:none
  • energize_resource:none
  • energize_amount:0.0

Spelldata

  • id:5405
  • name:Replenish Mana
  • school:physical
  • tooltip:Restoring $w2 mana every $t1 sec.
  • description:Restores {$s1=10}% mana.

Action Priority List

    shared_cds
    [q]:2.74
  • if_expr:(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Arcane Charge 58.1 181.8 5.2sec 1.2sec 3.8sec 73.98% 0.00% 27.0 (27.1) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_arcane_charge
  • max_stacks:4
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.9s / 12.3s
  • trigger_min/max:0.0s / 7.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 9.6s

Stack Uptimes

  • arcane_charge_1:19.03%
  • arcane_charge_2:16.45%
  • arcane_charge_3:16.90%
  • arcane_charge_4:21.60%

Spelldata

  • id:36032
  • name:Arcane Charge
  • tooltip:Increases the damage of Arcane Blast, Arcane Missiles, Arcane Explosion, and Arcane Barrage by $36032w1%. Increases the mana cost of Arcane Blast by $36032w2%$?{$w5<0}[, and reduces the cast time of Arcane Blast by $w5%.][.] Increases the number of targets hit by Arcane Barrage for 50% damage by $36032w3.
  • description:$@spelldesc114664
  • max_stacks:4
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Arcane Power 2.9 0.0 128.5sec 128.5sec 14.7sec 13.95% 0.00% 0.0 (0.0) 2.7

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_arcane_power
  • max_stacks:1
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:120.8s / 136.7s
  • trigger_min/max:120.8s / 136.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 15.0s

Stack Uptimes

  • arcane_power_1:13.95%

Spelldata

  • id:12042
  • name:Arcane Power
  • tooltip:Spell damage increased by $w1%. $?a343208[Mana costs of your damaging spells reduced by $w2%.][]
  • description:For {$d=10 seconds}, you deal {$s1=30}% more spell damage$?a343208[ and your spells cost {$s2=30}% less mana][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Berserking 1.9 0.0 256.8sec 256.8sec 11.7sec 7.18% 23.77% 0.0 (0.0) 1.8

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_berserking
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:253.9s / 265.7s
  • trigger_min/max:253.9s / 265.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • berserking_1:7.18%

Spelldata

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 40.0sec 13.49% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • base duration:40.00
  • duration modifier:1.00
  • base cooldown:300.00
  • default_chance:100.00%
  • default_value:0.30
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:40.0s / 40.0s

Stack Uptimes

  • bloodlust_1:13.49%

Spelldata

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Clearcasting 24.4 0.1 11.9sec 11.8sec 1.9sec 15.64% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_clearcasting
  • max_stacks:3
  • base duration:15.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-1.00
  • activated:true
  • reactable:true
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Stack Uptimes

  • clearcasting_1:15.54%
  • clearcasting_2:0.11%
  • clearcasting_3:0.01%

Spelldata

  • id:263725
  • name:Clearcasting
  • tooltip:Your next Arcane Missiles or Arcane Explosion costs no mana{$?s321758=false}[ and Arcane Missiles fires an additional missile][].
  • description:{$@spelldesc79684=For each ${$c*100/{$s1=200}} mana you spend, you have a 1% chance to gain Clearcasting, making your next Arcane Missiles or Arcane Explosion free and channel {$277726s1=20}% faster.$?a321758[ Arcane Missiles fires {$321758s2=1} additional missile.][]}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Evocation 1.2 0.0 166.9sec 166.9sec 4.3sec 1.72% 0.00% 4.8 (4.8) 0.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_evocation
  • max_stacks:1
  • base duration:6.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:7.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:hasted
  • period:1.00

Trigger Details

  • interval_min/max:94.5s / 259.6s
  • trigger_min/max:94.5s / 259.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 4.3s

Stack Uptimes

  • evocation_1:1.72%

Spelldata

  • id:12051
  • name:Evocation
  • tooltip:Mana regeneration increased by {$s1=750}%.
  • description:Increases your mana regeneration by {$s1=750}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Deathly Fixation 1.0 0.0 0.0sec 0.0sec 25.0sec 8.43% 0.00% 0.0 (0.0) 1.0

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_potion_of_deathly_fixation
  • max_stacks:1
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.0s / 25.0s

Stack Uptimes

  • potion_of_deathly_fixation_1:8.43%

Spelldata

  • id:307497
  • name:Potion of Deathly Fixation
  • tooltip:Chance to apply Deathly Fixation to your target.
  • description:Your damaging spells and abilities have a chance to apply Deathly Fixation to your target, dealing {$322253s1=43} Shadow damage over {$322253d=8 seconds} and stacking up to 5 times. Upon reaching 5 stacks, Deathly Fixation explodes, dealing {$322256s1=985} Shadow damage to the target. If you consume this potion while your weapon is augmented with Shadowcore Oil, the explosion damage is increased by {$s2=10}%. Lasts {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:0.00
  • default_chance:101.00%
Rune of Power 8.9 0.0 35.1sec 35.1sec 11.8sec 34.97% 0.00% 0.0 (0.0) 8.6

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • base duration:12.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:13.5s / 52.7s
  • trigger_min/max:13.5s / 52.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 12.0s

Stack Uptimes

  • rune_of_power_1:34.97%

Spelldata

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=12 seconds} which increases your spell damage by {$116014s1=40}% while you stand within 8 yds. Casting $?a137021[Arcane Power]?a137019[Combustion][Icy Veins] will also create a Rune of Power at your location.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Well Fed (feast_of_gluttonous_hedonism)

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_feast_of_gluttonous_hedonism
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:327708
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=20}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Spectral Flask of Power

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_spectral_flask_of_power
  • max_stacks:1
  • base duration:3600.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:307185
  • name:Spectral Flask of Power
  • tooltip:$pri increased by $w1.
  • description:Increases $pri by {$s1=70} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Procs, Uptimes & Benefits

Benefit Avg % Min Max
Arcane Barrage Arcane Charge 4 100.00% 100.00% 100.00%
Uptime Avg % Min Max Avg Dur Min Max
Mana Cap 2.14% 0.76% 5.78% 0.9s 0.0s 4.7s
Conserve Phase 100.00% 100.00% 100.00% 300.7s 240.1s 359.9s

Cooldown waste

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Mirror Image0.0000.0000.000180.660120.091239.937
Evocation137.2104.511326.417208.794124.325331.235
Rune of Power6.1961.14120.78238.84124.00252.240
Touch of the Magi4.9290.00021.53331.97222.39750.631
Arcane Power5.9720.76716.72517.2707.94127.020
Arcane Barrage2.7460.0038.280158.660126.314191.441
Arcane Orb3.5170.01310.48446.55533.73361.090

Burn Phases

Burn phase duration tracks the amount of time spent in each burn phase. This is defined as the time between a start_burn_phase and stop_burn_phase action being executed. Note that "execute" burn phases, i.e., the final burn of a fight, is also included.

Burn Phase Duration
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Mana at burn start is the mana level recorded (in percentage of total mana) when a start_burn_phase command is executed.

Mana at Burn Start
Count0
Minimum0.000
5th percentile0.000
Mean0.000
95th percentile0.000
Max0.000
Variance0.000
Mean Variance0.000
Mean Std. Dev0.000

Resources

Gains Type Count Total Tot% Avg Overflow Ovr%
arcane
mana_regen Mana 493.18 370589.62 63.34% 751.42 9795.44 2.58%
Evocation Mana 57.23 57533.04 9.83% 1005.33 0.00 0.00%
Mana Gem Mana 2.74 17393.43 2.97% 6337.14 0.00 0.00%
Arcane Barrage Mana 57.36 139582.46 23.86% 2433.25 5828.62 4.01%
Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max
Mana 62371.4 1946.21 2049.59 15636.8 32289.6 613.6 63371.4
Usage Type Count Total Avg RPE APR
arcane
arcane_explosion Mana 155.0 593815.3 3830.3 3830.5 3.9
arcane_orb Mana 13.1 5882.5 447.4 447.3 70.0
touch_of_the_magi Mana 6.2 15469.1 2500.0 2498.8 13.2

Statistics & Data Analysis

Fight Length
arcane Fight Length
Count 1018
Mean 300.66
Minimum 240.09
Maximum 359.94
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
arcane Damage Per Second
Count 1018
Mean 15848.31
Minimum 14571.02
Maximum 17265.15
Spread ( max - min ) 2694.13
Range [ ( max - min ) / 2 * 100% ] 8.50%
Standard Deviation 389.8629
5th Percentile 15232.74
95th Percentile 16468.69
( 95th Percentile - 5th Percentile ) 1235.95
Mean Distribution
Standard Deviation 12.2191
95.00% Confidence Interval ( 15824.37 - 15872.26 )
Normalized 95.00% Confidence Interval ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2325
0.1 Scale Factor Error with Delta=300 1298
0.05 Scale Factor Error with Delta=300 5191
0.01 Scale Factor Error with Delta=300 129751
Priority Target DPS
arcane Priority Target Damage Per Second
Count 1018
Mean 4331.51
Minimum 3783.84
Maximum 4842.51
Spread ( max - min ) 1058.67
Range [ ( max - min ) / 2 * 100% ] 12.22%
Standard Deviation 163.6331
5th Percentile 4065.42
95th Percentile 4595.80
( 95th Percentile - 5th Percentile ) 530.38
Mean Distribution
Standard Deviation 5.1286
95.00% Confidence Interval ( 4321.45 - 4341.56 )
Normalized 95.00% Confidence Interval ( 99.77% - 100.23% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5483
0.1 Scale Factor Error with Delta=300 229
0.05 Scale Factor Error with Delta=300 915
0.01 Scale Factor Error with Delta=300 22858
DPS(e)
arcane Damage Per Second (Effective)
Count 1018
Mean 15848.31
Minimum 14571.02
Maximum 17265.15
Spread ( max - min ) 2694.13
Range [ ( max - min ) / 2 * 100% ] 8.50%
Damage
arcane Damage
Count 1018
Mean 4757159.96
Minimum 3561153.56
Maximum 5769274.94
Spread ( max - min ) 2208121.37
Range [ ( max - min ) / 2 * 100% ] 23.21%
DTPS
arcane Damage Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
arcane Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
arcane Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
arcane Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
arcane Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
arcane Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
arcaneTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
arcane Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 variable,name=prepull_evo,op=reset,default=0
1 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
2 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
3 0.00 variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
4 0.00 variable,name=have_opened,op=reset,default=0
5 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
6 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
7 0.00 variable,name=final_burn,op=set,value=0
8 0.00 variable,name=rs_max_delay,op=reset,default=5
9 0.00 variable,name=ap_max_delay,op=reset,default=10
A 0.00 variable,name=rop_max_delay,op=reset,default=20
B 0.00 variable,name=totm_max_delay,op=reset,default=5
C 0.00 variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
D 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
E 0.00 variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
F 0.00 variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
G 0.00 variable,name=barrage_mana_pct,op=reset,default=70
H 0.00 variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
I 0.00 variable,name=ap_minimum_mana_pct,op=reset,default=30
J 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
K 0.00 variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
L 0.00 variable,name=totm_max_charges,op=reset,default=2
M 0.00 variable,name=aoe_totm_max_charges,op=reset,default=2
N 0.00 variable,name=am_spam,op=reset,default=0
O 0.00 variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
P 0.00 variable,name=am_spam_evo_pct,op=reset,default=15
Q 0.00 flask
R 0.00 food
S 0.00 augmentation
T 0.00 arcane_familiar
U 0.00 arcane_intellect
V 0.00 conjure_mana_gem
W 0.00 snapshot_stats
X 0.00 mirror_image
Y 0.00 frostbolt,if=variable.prepull_evo<=0
Z 0.00 evocation,if=variable.prepull_evo>0
Default action list Executed every time the actor is available.
# count action,conditions
0.00 counterspell,if=target.debuff.casting.react
a 0.00 call_action_list,name=shared_cds
b 0.00 call_action_list,name=essences
c 0.00 call_action_list,name=aoe,if=active_enemies>2
d 0.00 call_action_list,name=opener,if=variable.have_opened<=0
e 0.00 call_action_list,name=am_spam,if=variable.am_spam=1
f 0.00 call_action_list,name=cooldowns
g 0.00 call_action_list,name=rotation,if=variable.final_burn=0
h 0.00 call_action_list,name=final_burn,if=variable.final_burn=1
i 0.00 call_action_list,name=movement
actions.aoe
# count action,conditions
0.00 frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
0.00 arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
0.00 evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
0.00 mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
0.00 radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
0.00 radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
0.00 deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
j 6.20 touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
k 2.85 arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
l 6.07 rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
0.00 presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
0.00 arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
0.00 supernova
m 13.15 arcane_orb,if=buff.arcane_charge.stack=0
0.00 nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
0.00 shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
0.00 arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
n 155.03 arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
0.00 arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
o 57.36 arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
p 1.21 evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.shared_cds
# count action,conditions
q 2.74 use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
0.00 use_items,if=buff.arcane_power.up
r 1.00 potion,if=buff.arcane_power.up
0.00 time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
0.00 lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
0.00 bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
s 1.85 berserking,if=buff.arcane_power.up
0.00 blood_fury,if=buff.arcane_power.up
0.00 fireblood,if=buff.arcane_power.up
0.00 ancestral_call,if=buff.arcane_power.up

Sample Sequence

045789ABGILMNPQRVXYjkrsomonnnnonnnnonnnnlonnnqnomonnnnonnnnonnnnonnnnomonnnnonnnnojlonnnnomonnnnonpnnnomonnnnonnnnonjlomonnnnonnnnkonnnnomonnqnnonnnnonnnnojlomonnnnonnnnonnnnomonnnnonnnnonnnnojlomonnnnonnnnonnnnomonnnnonnnnonnnnojksomonnqnnonnnnlonnnnomo

Sample Sequence Table

Time List # Name Target Resources Buffs
Pre precombat 0 prepull_evo Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 4 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 5 have_opened Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 7 final_burn Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 8 rs_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat 9 ap_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat A rop_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat B totm_max_delay Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat G barrage_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat I ap_minimum_mana_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat L totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat M aoe_totm_max_charges Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat N am_spam Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat P am_spam_evo_pct Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Q flask arcane 63371.4/63371: 100% mana
Pre precombat R food arcane 63371.4/63371: 100% mana
Pre precombat V conjure_mana_gem Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat X mirror_image Fluffy_Pillow 63371.4/63371: 100% mana
Pre precombat Y frostbolt Fluffy_Pillow 63371.4/63371: 100% mana
0:00.000 aoe j touch_of_the_magi Fluffy_Pillow 62371.4/63371: 98% mana
0:01.307 aoe k arcane_power Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4)
0:01.307 shared_cds r potion Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power
0:01.307 shared_cds s berserking Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:01.307 aoe o arcane_barrage Fluffy_Pillow 60877.8/63371: 96% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:02.221 aoe m arcane_orb Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:03.133 aoe o arcane_barrage Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.048 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:04.961 aoe n arcane_explosion Fluffy_Pillow 62028.6/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:05.875 aoe n arcane_explosion Fluffy_Pillow 60687.0/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, clearcasting, rune_of_power, potion_of_deathly_fixation
0:06.789 aoe n arcane_explosion Fluffy_Pillow 61845.5/63371: 98% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:07.705 aoe o arcane_barrage Fluffy_Pillow 60506.4/63371: 95% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:08.620 aoe n arcane_explosion Fluffy_Pillow 63371.4/63371: 100% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:09.534 aoe n arcane_explosion Fluffy_Pillow 62029.9/63371: 98% mana bloodlust, berserking, arcane_charge, arcane_power, rune_of_power, potion_of_deathly_fixation
0:10.448 aoe n arcane_explosion Fluffy_Pillow 60688.3/63371: 96% mana bloodlust, berserking, arcane_charge(2), arcane_power, rune_of_power, potion_of_deathly_fixation
0:11.362 aoe n arcane_explosion Fluffy_Pillow 59346.7/63371: 94% mana bloodlust, berserking, arcane_charge(3), arcane_power, rune_of_power, potion_of_deathly_fixation
0:12.278 aoe o arcane_barrage Fluffy_Pillow 58007.7/63371: 92% mana bloodlust, berserking, arcane_charge(4), arcane_power, rune_of_power, potion_of_deathly_fixation
0:13.192 aoe n arcane_explosion Fluffy_Pillow 61701.0/63371: 97% mana bloodlust, berserking, arcane_power, rune_of_power, potion_of_deathly_fixation
0:14.108 aoe n arcane_explosion Fluffy_Pillow 60361.9/63371: 95% mana bloodlust, arcane_charge, arcane_power, potion_of_deathly_fixation
0:15.114 aoe n arcane_explosion Fluffy_Pillow 59137.0/63371: 93% mana bloodlust, arcane_charge(2), arcane_power, potion_of_deathly_fixation
0:16.121 aoe n arcane_explosion Fluffy_Pillow 57913.3/63371: 91% mana bloodlust, arcane_charge(3), arcane_power, potion_of_deathly_fixation
0:17.127 aoe l rune_of_power Fluffy_Pillow 56688.3/63371: 89% mana bloodlust, arcane_charge(4), potion_of_deathly_fixation
0:18.133 aoe o arcane_barrage Fluffy_Pillow 57963.3/63371: 91% mana bloodlust, arcane_charge(4), rune_of_power, potion_of_deathly_fixation
0:19.141 aoe n arcane_explosion Fluffy_Pillow 61775.8/63371: 97% mana bloodlust, rune_of_power, potion_of_deathly_fixation
0:20.148 aoe n arcane_explosion Fluffy_Pillow 58052.1/63371: 92% mana bloodlust, arcane_charge, rune_of_power, potion_of_deathly_fixation
0:21.155 aoe n arcane_explosion Fluffy_Pillow 54328.4/63371: 86% mana bloodlust, arcane_charge(2), rune_of_power, potion_of_deathly_fixation
0:22.161 shared_cds q use_mana_gem arcane 50603.4/63371: 80% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:22.161 aoe n arcane_explosion Fluffy_Pillow 56940.5/63371: 90% mana bloodlust, arcane_charge(3), rune_of_power, potion_of_deathly_fixation
0:23.168 aoe o arcane_barrage Fluffy_Pillow 53216.8/63371: 84% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:24.174 aoe m arcane_orb Fluffy_Pillow 57026.7/63371: 90% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:25.181 aoe o arcane_barrage Fluffy_Pillow 57803.0/63371: 91% mana bloodlust, arcane_charge(4), clearcasting, rune_of_power, potion_of_deathly_fixation
0:26.187 aoe n arcane_explosion Fluffy_Pillow 61612.9/63371: 97% mana bloodlust, clearcasting, rune_of_power, potion_of_deathly_fixation
0:27.194 aoe n arcane_explosion Fluffy_Pillow 62889.2/63371: 99% mana bloodlust, arcane_charge, rune_of_power
0:28.200 aoe n arcane_explosion Fluffy_Pillow 59164.3/63371: 93% mana bloodlust, arcane_charge(2), rune_of_power
0:29.206 aoe n arcane_explosion Fluffy_Pillow 55439.3/63371: 87% mana bloodlust, arcane_charge(3), rune_of_power
0:30.211 aoe o arcane_barrage Fluffy_Pillow 51713.1/63371: 82% mana bloodlust, arcane_charge(4)
0:31.216 aoe n arcane_explosion Fluffy_Pillow 55521.7/63371: 88% mana bloodlust
0:32.222 aoe n arcane_explosion Fluffy_Pillow 51796.7/63371: 82% mana bloodlust, arcane_charge
0:33.229 aoe n arcane_explosion Fluffy_Pillow 48073.0/63371: 76% mana bloodlust, arcane_charge(2)
0:34.235 aoe n arcane_explosion Fluffy_Pillow 44348.0/63371: 70% mana bloodlust, arcane_charge(3)
0:35.241 aoe o arcane_barrage Fluffy_Pillow 40623.1/63371: 64% mana bloodlust, arcane_charge(4)
0:36.247 aoe n arcane_explosion Fluffy_Pillow 44433.0/63371: 70% mana bloodlust
0:37.253 aoe n arcane_explosion Fluffy_Pillow 40708.0/63371: 64% mana bloodlust, arcane_charge
0:38.259 aoe n arcane_explosion Fluffy_Pillow 36983.0/63371: 58% mana bloodlust, arcane_charge(2)
0:39.266 aoe n arcane_explosion Fluffy_Pillow 33259.3/63371: 52% mana bloodlust, arcane_charge(3)
0:40.274 aoe o arcane_barrage Fluffy_Pillow 29536.9/63371: 47% mana bloodlust, arcane_charge(4)
0:41.281 aoe n arcane_explosion Fluffy_Pillow 33348.1/63371: 53% mana
0:42.587 aoe n arcane_explosion Fluffy_Pillow 30003.3/63371: 47% mana arcane_charge
0:43.894 aoe n arcane_explosion Fluffy_Pillow 26659.8/63371: 42% mana arcane_charge(2)
0:45.201 aoe n arcane_explosion Fluffy_Pillow 23316.4/63371: 37% mana arcane_charge(3)
0:46.506 aoe o arcane_barrage Fluffy_Pillow 19970.4/63371: 32% mana arcane_charge(4)
0:47.812 aoe m arcane_orb Fluffy_Pillow 24160.5/63371: 38% mana
0:49.118 aoe o arcane_barrage Fluffy_Pillow 25315.8/63371: 40% mana arcane_charge(4)
0:50.425 aoe n arcane_explosion Fluffy_Pillow 29507.1/63371: 47% mana
0:51.731 aoe n arcane_explosion Fluffy_Pillow 26162.4/63371: 41% mana arcane_charge
0:53.039 aoe n arcane_explosion Fluffy_Pillow 22820.2/63371: 36% mana arcane_charge(2)
0:54.344 aoe n arcane_explosion Fluffy_Pillow 19474.2/63371: 31% mana arcane_charge(3)
0:55.651 aoe o arcane_barrage Fluffy_Pillow 16130.7/63371: 25% mana arcane_charge(4), clearcasting
0:56.958 aoe n arcane_explosion Fluffy_Pillow 20322.1/63371: 32% mana clearcasting
0:58.264 aoe n arcane_explosion Fluffy_Pillow 21977.4/63371: 35% mana arcane_charge
0:59.570 aoe n arcane_explosion Fluffy_Pillow 18632.6/63371: 29% mana arcane_charge(2)
1:00.877 aoe n arcane_explosion Fluffy_Pillow 15289.2/63371: 24% mana arcane_charge(3)
1:02.183 aoe o arcane_barrage Fluffy_Pillow 11944.4/63371: 19% mana arcane_charge(4)
1:03.488 aoe j touch_of_the_magi Fluffy_Pillow 16133.3/63371: 25% mana
1:04.794 aoe l rune_of_power Fluffy_Pillow 15288.5/63371: 24% mana arcane_charge(4)
1:06.100 aoe o arcane_barrage Fluffy_Pillow 16943.8/63371: 27% mana arcane_charge(4), rune_of_power
1:07.407 aoe n arcane_explosion Fluffy_Pillow 21135.2/63371: 33% mana rune_of_power
1:08.712 aoe n arcane_explosion Fluffy_Pillow 17789.2/63371: 28% mana arcane_charge, rune_of_power
1:10.020 aoe n arcane_explosion Fluffy_Pillow 14447.0/63371: 23% mana arcane_charge(2), rune_of_power
1:11.326 aoe n arcane_explosion Fluffy_Pillow 11102.2/63371: 18% mana arcane_charge(3), rune_of_power
1:12.633 aoe o arcane_barrage Fluffy_Pillow 7758.8/63371: 12% mana arcane_charge(4), rune_of_power
1:13.939 aoe m arcane_orb Fluffy_Pillow 11948.9/63371: 19% mana rune_of_power
1:15.247 aoe o arcane_barrage Fluffy_Pillow 13106.7/63371: 21% mana arcane_charge(4), rune_of_power
1:16.554 aoe n arcane_explosion Fluffy_Pillow 17298.1/63371: 27% mana rune_of_power
1:17.860 aoe n arcane_explosion Fluffy_Pillow 13953.3/63371: 22% mana arcane_charge, rune_of_power
1:19.166 aoe n arcane_explosion Fluffy_Pillow 10608.6/63371: 17% mana arcane_charge(2)
1:20.474 aoe n arcane_explosion Fluffy_Pillow 7266.4/63371: 11% mana arcane_charge(3)
1:21.780 aoe o arcane_barrage Fluffy_Pillow 3921.6/63371: 6% mana arcane_charge(4)
1:23.087 aoe n arcane_explosion Fluffy_Pillow 8113.0/63371: 13% mana
1:24.395 aoe p evocation arcane 4770.8/63371: 8% mana arcane_charge
1:28.739 aoe n arcane_explosion Fluffy_Pillow 58615.5/63371: 92% mana arcane_charge
1:30.045 aoe n arcane_explosion Fluffy_Pillow 55270.8/63371: 87% mana arcane_charge(2)
1:31.351 aoe n arcane_explosion Fluffy_Pillow 51926.0/63371: 82% mana arcane_charge(3)
1:32.656 aoe o arcane_barrage Fluffy_Pillow 48580.0/63371: 77% mana arcane_charge(4)
1:33.963 aoe m arcane_orb Fluffy_Pillow 52771.4/63371: 83% mana
1:35.270 aoe o arcane_barrage Fluffy_Pillow 53927.9/63371: 85% mana arcane_charge(4)
1:36.578 aoe n arcane_explosion Fluffy_Pillow 58120.6/63371: 92% mana
1:37.882 aoe n arcane_explosion Fluffy_Pillow 54773.3/63371: 86% mana arcane_charge
1:39.189 aoe n arcane_explosion Fluffy_Pillow 51429.8/63371: 81% mana arcane_charge(2)
1:40.496 aoe n arcane_explosion Fluffy_Pillow 48086.4/63371: 76% mana arcane_charge(3)
1:41.803 aoe o arcane_barrage Fluffy_Pillow 44742.9/63371: 71% mana arcane_charge(4)
1:43.109 aoe n arcane_explosion Fluffy_Pillow 48933.0/63371: 77% mana
1:44.414 aoe n arcane_explosion Fluffy_Pillow 45587.0/63371: 72% mana arcane_charge
1:45.722 aoe n arcane_explosion Fluffy_Pillow 42244.8/63371: 67% mana arcane_charge(2)
1:47.029 aoe n arcane_explosion Fluffy_Pillow 38901.3/63371: 61% mana arcane_charge(3)
1:48.335 aoe o arcane_barrage Fluffy_Pillow 35556.6/63371: 56% mana arcane_charge(4)
1:49.642 aoe n arcane_explosion Fluffy_Pillow 39748.0/63371: 63% mana
1:50.948 aoe j touch_of_the_magi Fluffy_Pillow 36403.2/63371: 57% mana arcane_charge
1:52.255 aoe l rune_of_power Fluffy_Pillow 35559.8/63371: 56% mana arcane_charge(4)
1:53.562 aoe o arcane_barrage Fluffy_Pillow 37216.3/63371: 59% mana arcane_charge(4), rune_of_power
1:54.869 aoe m arcane_orb Fluffy_Pillow 41407.7/63371: 65% mana rune_of_power
1:56.176 aoe o arcane_barrage Fluffy_Pillow 42564.2/63371: 67% mana arcane_charge(4), rune_of_power
1:57.483 aoe n arcane_explosion Fluffy_Pillow 46755.6/63371: 74% mana rune_of_power
1:58.790 aoe n arcane_explosion Fluffy_Pillow 43412.1/63371: 69% mana arcane_charge, rune_of_power
2:00.096 aoe n arcane_explosion Fluffy_Pillow 40067.4/63371: 63% mana arcane_charge(2), rune_of_power
2:01.404 aoe n arcane_explosion Fluffy_Pillow 36725.2/63371: 58% mana arcane_charge(3), rune_of_power
2:02.709 aoe o arcane_barrage Fluffy_Pillow 33379.2/63371: 53% mana arcane_charge(4), rune_of_power
2:04.017 aoe n arcane_explosion Fluffy_Pillow 37571.8/63371: 59% mana rune_of_power
2:05.323 aoe n arcane_explosion Fluffy_Pillow 34227.1/63371: 54% mana arcane_charge, rune_of_power
2:06.630 aoe n arcane_explosion Fluffy_Pillow 30883.6/63371: 49% mana arcane_charge(2)
2:07.935 aoe n arcane_explosion Fluffy_Pillow 27537.6/63371: 43% mana arcane_charge(3)
2:09.243 aoe k arcane_power Fluffy_Pillow 24195.4/63371: 38% mana arcane_charge(4)
2:09.243 aoe o arcane_barrage Fluffy_Pillow 24195.4/63371: 38% mana arcane_charge(4), arcane_power, rune_of_power
2:10.549 aoe n arcane_explosion Fluffy_Pillow 28385.5/63371: 45% mana arcane_power, rune_of_power
2:11.856 aoe n arcane_explosion Fluffy_Pillow 27542.1/63371: 43% mana arcane_charge, arcane_power, rune_of_power
2:13.159 aoe n arcane_explosion Fluffy_Pillow 26693.5/63371: 42% mana arcane_charge(2), arcane_power, rune_of_power
2:14.465 aoe n arcane_explosion Fluffy_Pillow 25848.8/63371: 41% mana arcane_charge(3), arcane_power, rune_of_power
2:15.770 aoe o arcane_barrage Fluffy_Pillow 25002.8/63371: 39% mana arcane_charge(4), arcane_power, rune_of_power
2:17.077 aoe m arcane_orb Fluffy_Pillow 29194.2/63371: 46% mana arcane_power, rune_of_power
2:18.385 aoe o arcane_barrage Fluffy_Pillow 30602.0/63371: 48% mana arcane_charge(4), arcane_power, rune_of_power
2:19.691 aoe n arcane_explosion Fluffy_Pillow 34792.1/63371: 55% mana arcane_power, rune_of_power
2:20.997 aoe n arcane_explosion Fluffy_Pillow 33947.3/63371: 54% mana arcane_charge, arcane_power, rune_of_power
2:22.302 shared_cds q use_mana_gem arcane 33101.3/63371: 52% mana arcane_charge(2), arcane_power
2:22.302 aoe n arcane_explosion Fluffy_Pillow 39438.5/63371: 62% mana arcane_charge(2), arcane_power
2:23.609 aoe n arcane_explosion Fluffy_Pillow 38595.0/63371: 61% mana arcane_charge(3), arcane_power
2:24.914 aoe o arcane_barrage Fluffy_Pillow 37749.0/63371: 60% mana arcane_charge(4)
2:26.220 aoe n arcane_explosion Fluffy_Pillow 41939.1/63371: 66% mana
2:27.528 aoe n arcane_explosion Fluffy_Pillow 38596.9/63371: 61% mana arcane_charge, clearcasting
2:28.835 aoe n arcane_explosion Fluffy_Pillow 40253.5/63371: 64% mana arcane_charge(2)
2:30.141 aoe n arcane_explosion Fluffy_Pillow 36908.7/63371: 58% mana arcane_charge(3)
2:31.447 aoe o arcane_barrage Fluffy_Pillow 33564.0/63371: 53% mana arcane_charge(4), clearcasting
2:32.752 aoe n arcane_explosion Fluffy_Pillow 37752.8/63371: 60% mana clearcasting
2:34.058 aoe n arcane_explosion Fluffy_Pillow 39408.1/63371: 62% mana arcane_charge
2:35.364 aoe n arcane_explosion Fluffy_Pillow 36063.4/63371: 57% mana arcane_charge(2)
2:36.671 aoe n arcane_explosion Fluffy_Pillow 32719.9/63371: 52% mana arcane_charge(3), clearcasting
2:37.977 aoe o arcane_barrage Fluffy_Pillow 34375.1/63371: 54% mana arcane_charge(4)
2:39.284 aoe j touch_of_the_magi Fluffy_Pillow 38566.5/63371: 61% mana
2:40.591 aoe l rune_of_power Fluffy_Pillow 37723.1/63371: 60% mana arcane_charge(4)
2:41.898 aoe o arcane_barrage Fluffy_Pillow 39379.6/63371: 62% mana arcane_charge(4), rune_of_power
2:43.204 aoe m arcane_orb Fluffy_Pillow 43569.7/63371: 69% mana rune_of_power
2:44.511 aoe o arcane_barrage Fluffy_Pillow 44726.2/63371: 71% mana arcane_charge(4), rune_of_power
2:45.819 aoe n arcane_explosion Fluffy_Pillow 48918.9/63371: 77% mana rune_of_power
2:47.125 aoe n arcane_explosion Fluffy_Pillow 45574.2/63371: 72% mana arcane_charge, rune_of_power
2:48.431 aoe n arcane_explosion Fluffy_Pillow 42229.4/63371: 67% mana arcane_charge(2), rune_of_power
2:49.736 aoe n arcane_explosion Fluffy_Pillow 38883.4/63371: 61% mana arcane_charge(3), rune_of_power
2:51.043 aoe o arcane_barrage Fluffy_Pillow 35539.9/63371: 56% mana arcane_charge(4), rune_of_power
2:52.349 aoe n arcane_explosion Fluffy_Pillow 39730.1/63371: 63% mana rune_of_power
2:53.656 aoe n arcane_explosion Fluffy_Pillow 36386.6/63371: 57% mana arcane_charge, rune_of_power
2:54.962 aoe n arcane_explosion Fluffy_Pillow 33041.8/63371: 52% mana arcane_charge(2)
2:56.269 aoe n arcane_explosion Fluffy_Pillow 29698.4/63371: 47% mana arcane_charge(3)
2:57.573 aoe o arcane_barrage Fluffy_Pillow 26351.1/63371: 42% mana arcane_charge(4)
2:58.877 aoe n arcane_explosion Fluffy_Pillow 30538.7/63371: 48% mana
3:00.184 aoe n arcane_explosion Fluffy_Pillow 27195.2/63371: 43% mana arcane_charge
3:01.490 aoe n arcane_explosion Fluffy_Pillow 23850.5/63371: 38% mana arcane_charge(2)
3:02.796 aoe n arcane_explosion Fluffy_Pillow 20505.7/63371: 32% mana arcane_charge(3), clearcasting
3:04.102 aoe o arcane_barrage Fluffy_Pillow 22161.0/63371: 35% mana arcane_charge(4)
3:05.411 aoe m arcane_orb Fluffy_Pillow 26354.9/63371: 42% mana
3:06.719 aoe o arcane_barrage Fluffy_Pillow 27512.7/63371: 43% mana arcane_charge(4)
3:08.024 aoe n arcane_explosion Fluffy_Pillow 31701.6/63371: 50% mana
3:09.332 aoe n arcane_explosion Fluffy_Pillow 28359.4/63371: 45% mana arcane_charge
3:10.639 aoe n arcane_explosion Fluffy_Pillow 25015.9/63371: 39% mana arcane_charge(2)
3:11.947 aoe n arcane_explosion Fluffy_Pillow 21673.7/63371: 34% mana arcane_charge(3)
3:13.255 aoe o arcane_barrage Fluffy_Pillow 18331.5/63371: 29% mana arcane_charge(4), clearcasting
3:14.562 aoe n arcane_explosion Fluffy_Pillow 22522.9/63371: 36% mana clearcasting
3:15.870 aoe n arcane_explosion Fluffy_Pillow 24180.7/63371: 38% mana arcane_charge
3:17.177 aoe n arcane_explosion Fluffy_Pillow 20837.2/63371: 33% mana arcane_charge(2), clearcasting
3:18.483 aoe n arcane_explosion Fluffy_Pillow 22492.5/63371: 35% mana arcane_charge(3)
3:19.791 aoe o arcane_barrage Fluffy_Pillow 19150.3/63371: 30% mana arcane_charge(4)
3:21.096 aoe n arcane_explosion Fluffy_Pillow 23339.1/63371: 37% mana
3:22.404 aoe n arcane_explosion Fluffy_Pillow 19996.9/63371: 32% mana arcane_charge, clearcasting
3:23.712 aoe n arcane_explosion Fluffy_Pillow 21654.7/63371: 34% mana arcane_charge(2)
3:25.018 aoe n arcane_explosion Fluffy_Pillow 18310.0/63371: 29% mana arcane_charge(3)
3:26.324 aoe o arcane_barrage Fluffy_Pillow 14965.2/63371: 24% mana arcane_charge(4), clearcasting
3:27.633 aoe j touch_of_the_magi Fluffy_Pillow 19159.1/63371: 30% mana clearcasting
3:28.940 aoe l rune_of_power Fluffy_Pillow 18315.7/63371: 29% mana arcane_charge(4), clearcasting
3:30.246 aoe o arcane_barrage Fluffy_Pillow 19970.9/63371: 32% mana arcane_charge(4), clearcasting, rune_of_power
3:31.553 aoe m arcane_orb Fluffy_Pillow 24162.3/63371: 38% mana clearcasting, rune_of_power
3:32.860 aoe o arcane_barrage Fluffy_Pillow 25318.9/63371: 40% mana arcane_charge(4), clearcasting, rune_of_power
3:34.167 aoe n arcane_explosion Fluffy_Pillow 29510.2/63371: 47% mana clearcasting, rune_of_power
3:35.476 aoe n arcane_explosion Fluffy_Pillow 31169.3/63371: 49% mana arcane_charge, rune_of_power
3:36.782 aoe n arcane_explosion Fluffy_Pillow 27824.6/63371: 44% mana arcane_charge(2), clearcasting, rune_of_power
3:38.089 aoe n arcane_explosion Fluffy_Pillow 29481.1/63371: 47% mana arcane_charge(3), rune_of_power
3:39.394 aoe o arcane_barrage Fluffy_Pillow 26135.1/63371: 41% mana arcane_charge(4), clearcasting, rune_of_power
3:40.702 aoe n arcane_explosion Fluffy_Pillow 30327.7/63371: 48% mana clearcasting, rune_of_power
3:42.010 aoe n arcane_explosion Fluffy_Pillow 31985.5/63371: 50% mana arcane_charge, rune_of_power
3:43.318 aoe n arcane_explosion Fluffy_Pillow 28643.3/63371: 45% mana arcane_charge(2), clearcasting
3:44.623 aoe n arcane_explosion Fluffy_Pillow 30297.3/63371: 48% mana arcane_charge(3)
3:45.929 aoe o arcane_barrage Fluffy_Pillow 26952.6/63371: 43% mana arcane_charge(4)
3:47.237 aoe n arcane_explosion Fluffy_Pillow 31145.2/63371: 49% mana
3:48.544 aoe n arcane_explosion Fluffy_Pillow 27801.8/63371: 44% mana arcane_charge
3:49.850 aoe n arcane_explosion Fluffy_Pillow 24457.0/63371: 39% mana arcane_charge(2)
3:51.155 aoe n arcane_explosion Fluffy_Pillow 21111.0/63371: 33% mana arcane_charge(3), clearcasting
3:52.461 aoe o arcane_barrage Fluffy_Pillow 22766.3/63371: 36% mana arcane_charge(4)
3:53.769 aoe m arcane_orb Fluffy_Pillow 26958.9/63371: 43% mana
3:55.077 aoe o arcane_barrage Fluffy_Pillow 28116.7/63371: 44% mana arcane_charge(4)
3:56.383 aoe n arcane_explosion Fluffy_Pillow 32306.9/63371: 51% mana
3:57.689 aoe n arcane_explosion Fluffy_Pillow 28962.1/63371: 46% mana arcane_charge
3:58.996 aoe n arcane_explosion Fluffy_Pillow 25618.7/63371: 40% mana arcane_charge(2), clearcasting
4:00.302 aoe n arcane_explosion Fluffy_Pillow 27273.9/63371: 43% mana arcane_charge(3)
4:01.609 aoe o arcane_barrage Fluffy_Pillow 23930.4/63371: 38% mana arcane_charge(4)
4:02.914 aoe n arcane_explosion Fluffy_Pillow 28119.3/63371: 44% mana
4:04.222 aoe n arcane_explosion Fluffy_Pillow 24777.1/63371: 39% mana arcane_charge
4:05.527 aoe n arcane_explosion Fluffy_Pillow 21431.1/63371: 34% mana arcane_charge(2), clearcasting
4:06.834 aoe n arcane_explosion Fluffy_Pillow 23087.6/63371: 36% mana arcane_charge(3)
4:08.141 aoe o arcane_barrage Fluffy_Pillow 19744.1/63371: 31% mana arcane_charge(4)
4:09.450 aoe n arcane_explosion Fluffy_Pillow 23938.1/63371: 38% mana
4:10.756 aoe n arcane_explosion Fluffy_Pillow 20593.3/63371: 32% mana arcane_charge, clearcasting
4:12.062 aoe n arcane_explosion Fluffy_Pillow 22248.6/63371: 35% mana arcane_charge(2)
4:13.369 aoe n arcane_explosion Fluffy_Pillow 18905.1/63371: 30% mana arcane_charge(3)
4:14.674 aoe o arcane_barrage Fluffy_Pillow 15559.1/63371: 25% mana arcane_charge(4)
4:15.981 aoe j touch_of_the_magi Fluffy_Pillow 19750.5/63371: 31% mana
4:17.287 aoe k arcane_power Fluffy_Pillow 18905.8/63371: 30% mana arcane_charge(4)
4:17.287 shared_cds s berserking Fluffy_Pillow 18905.8/63371: 30% mana arcane_charge(4), arcane_power, rune_of_power
4:17.287 aoe o arcane_barrage Fluffy_Pillow 18905.8/63371: 30% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:18.474 aoe m arcane_orb Fluffy_Pillow 22945.1/63371: 36% mana berserking, arcane_power, rune_of_power
4:19.663 aoe o arcane_barrage Fluffy_Pillow 24202.0/63371: 38% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:20.852 aoe n arcane_explosion Fluffy_Pillow 28243.9/63371: 45% mana berserking, arcane_power, rune_of_power
4:22.039 aoe n arcane_explosion Fluffy_Pillow 27248.3/63371: 43% mana berserking, arcane_charge, arcane_power, rune_of_power
4:23.228 shared_cds q use_mana_gem arcane 26255.3/63371: 41% mana berserking, arcane_charge(2), arcane_power, clearcasting, rune_of_power
4:23.228 aoe n arcane_explosion Fluffy_Pillow 32592.4/63371: 51% mana berserking, arcane_charge(2), arcane_power, clearcasting, rune_of_power
4:24.416 aoe n arcane_explosion Fluffy_Pillow 34098.1/63371: 54% mana berserking, arcane_charge(3), arcane_power, rune_of_power
4:25.603 aoe o arcane_barrage Fluffy_Pillow 33102.6/63371: 52% mana berserking, arcane_charge(4), arcane_power, rune_of_power
4:26.794 aoe n arcane_explosion Fluffy_Pillow 37146.9/63371: 59% mana berserking, arcane_power, rune_of_power
4:27.984 aoe n arcane_explosion Fluffy_Pillow 36155.2/63371: 57% mana berserking, arcane_charge, arcane_power, clearcasting, rune_of_power
4:29.173 aoe n arcane_explosion Fluffy_Pillow 37662.1/63371: 59% mana berserking, arcane_charge(2), arcane_power, rune_of_power
4:30.363 aoe n arcane_explosion Fluffy_Pillow 36670.4/63371: 58% mana arcane_charge(3), arcane_power
4:31.669 aoe l rune_of_power Fluffy_Pillow 35825.6/63371: 57% mana arcane_charge(4), arcane_power
4:32.976 aoe o arcane_barrage Fluffy_Pillow 37482.2/63371: 59% mana arcane_charge(4), rune_of_power
4:34.284 aoe n arcane_explosion Fluffy_Pillow 41674.8/63371: 66% mana rune_of_power
4:35.589 aoe n arcane_explosion Fluffy_Pillow 38328.8/63371: 60% mana arcane_charge, clearcasting, rune_of_power
4:36.893 aoe n arcane_explosion Fluffy_Pillow 39981.5/63371: 63% mana arcane_charge(2), rune_of_power
4:38.198 aoe n arcane_explosion Fluffy_Pillow 36635.5/63371: 58% mana arcane_charge(3), rune_of_power
4:39.504 aoe o arcane_barrage Fluffy_Pillow 33290.8/63371: 53% mana arcane_charge(4), rune_of_power
4:40.810 aoe m arcane_orb Fluffy_Pillow 37480.9/63371: 59% mana rune_of_power
4:42.116 aoe o arcane_barrage Fluffy_Pillow 38636.2/63371: 61% mana arcane_charge(4), rune_of_power

Stats

Level Bonus (60) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 198 1 199 199 0
Agility 306 2 308 308 0
Stamina 414 0 434 414 0
Intellect 450 -3 2453 2247 1800
Spirit 0 0 0 0 0
Health 8680 8280 0
Mana 63371 63371 0
Spell Power 2453 2247 0
Crit 19.29% 19.29% 500
Haste 15.15% 15.15% 500
Versatility 12.50% 12.50% 500
Mana Regen 1267 1267 0
Mastery 26.74% 26.74% 500
Armor 0 0 0
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 0.00

Profile

mage="arcane"
source=default
spec=arcane
level=60
race=troll
role=spell
position=back
talents=1032021

# Default consumables
potion=deathly_fixation
flask=spectral_flask_of_power
food=feast_of_gluttonous_hedonism
augmentation=disabled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=variable,name=prepull_evo,op=reset,default=0
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&active_enemies>2
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.necrolord.enabled&active_enemies>1
actions.precombat+=/variable,name=prepull_evo,op=set,value=1,if=variable.prepull_evo=0&runeforge.siphon_storm.equipped&covenant.night_fae.enabled
actions.precombat+=/variable,name=have_opened,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&active_enemies>2
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.prepull_evo=1
actions.precombat+=/variable,name=final_burn,op=set,value=0
actions.precombat+=/variable,name=rs_max_delay,op=reset,default=5
actions.precombat+=/variable,name=ap_max_delay,op=reset,default=10
actions.precombat+=/variable,name=rop_max_delay,op=reset,default=20
actions.precombat+=/variable,name=totm_max_delay,op=reset,default=5
actions.precombat+=/variable,name=totm_max_delay,op=set,value=3,if=variable.totm_max_delay=5&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&covenant.night_fae.enabled
actions.precombat+=/variable,name=totm_max_delay,op=set,value=15,if=variable.totm_max_delay=5&conduit.arcane_prodigy.enabled&active_enemies<3
actions.precombat+=/variable,name=totm_max_delay,op=set,value=30,if=variable.totm_max_delay=5&essence.vision_of_perfection.minor
actions.precombat+=/variable,name=barrage_mana_pct,op=reset,default=70
actions.precombat+=/variable,name=barrage_mana_pct,op=set,value=40,if=variable.barrage_mana_pct=70&covenant.night_fae.enabled
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=reset,default=30
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.disciplinary_command.equipped
actions.precombat+=/variable,name=ap_minimum_mana_pct,op=set,value=50,if=variable.ap_minimum_mana_pct=30&runeforge.grisly_icicle.equipped
actions.precombat+=/variable,name=totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=aoe_totm_max_charges,op=reset,default=2
actions.precombat+=/variable,name=am_spam,op=reset,default=0
actions.precombat+=/variable,name=have_opened,op=set,value=1,if=variable.have_opened=0&variable.am_spam=1
actions.precombat+=/variable,name=am_spam_evo_pct,op=reset,default=15
actions.precombat+=/flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/arcane_familiar
actions.precombat+=/arcane_intellect
actions.precombat+=/conjure_mana_gem
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/frostbolt,if=variable.prepull_evo<=0
actions.precombat+=/evocation,if=variable.prepull_evo>0

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/call_action_list,name=shared_cds
actions+=/call_action_list,name=essences
actions+=/call_action_list,name=aoe,if=active_enemies>2
actions+=/call_action_list,name=opener,if=variable.have_opened<=0
actions+=/call_action_list,name=am_spam,if=variable.am_spam=1
actions+=/call_action_list,name=cooldowns
actions+=/call_action_list,name=rotation,if=variable.final_burn=0
actions+=/call_action_list,name=final_burn,if=variable.final_burn=1
actions+=/call_action_list,name=movement

actions.am_spam=cancel_action,if=action.evocation.channeling&mana.pct>=95
actions.am_spam+=/evocation,if=mana.pct<=variable.am_spam_evo_pct&(cooldown.touch_of_the_magi.remains<=action.evocation.execute_time|cooldown.arcane_power.remains<=action.evocation.execute_time|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=action.evocation.execute_time))&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/rune_of_power,if=buff.rune_of_power.down&cooldown.arcane_power.remains>0
actions.am_spam+=/touch_of_the_magi,if=(cooldown.arcane_power.remains=0&buff.rune_of_power.down)|prev_gcd.1.rune_of_power
actions.am_spam+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&buff.rune_of_power.down&essence.vision_of_perfection.enabled
actions.am_spam+=/arcane_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.ap_max_delay
actions.am_spam+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=action.arcane_missiles.execute_time&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack&buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_barrage,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.am_spam+=/arcane_missiles,if=buff.clearcasting.react,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/arcane_missiles,if=!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down,chain=1,early_chain_if=buff.clearcasting_channel.down&(buff.arcane_power.up|buff.rune_of_power.up|cooldown.evocation.ready)
actions.am_spam+=/evocation,if=buff.rune_of_power.down&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.am_spam+=/arcane_orb,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.am_spam+=/arcane_barrage
actions.am_spam+=/arcane_blast

actions.aoe=frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/fire_blast,if=(runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt)|(runeforge.disciplinary_command.equipped&time=0)
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=runeforge.siphon_storm.equipped&prev_gcd.1.evocation
actions.aoe+=/arcane_power,if=runeforge.siphon_storm.equipped&(prev_gcd.1.evocation|prev_gcd.1.touch_of_the_magi)
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&cooldown.touch_of_the_magi.remains=0&cooldown.arcane_power.remains<=gcd
actions.aoe+=/evocation,if=time>30&runeforge.siphon_storm.equipped&cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down),interrupt_if=buff.siphon_storm.stack=buff.siphon_storm.max_stack,interrupt_immediate=1
actions.aoe+=/mirrors_of_torment,if=(cooldown.arcane_power.remains>45|cooldown.arcane_power.remains<=3)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>5)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>5)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack<=variable.aoe_totm_max_charges&debuff.touch_of_the_magi.down
actions.aoe+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.aoe+=/radiant_spark,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/deathborne,if=cooldown.arcane_power.remains=0&(((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down)
actions.aoe+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.aoe_totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd)
actions.aoe+=/arcane_power,if=((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&buff.rune_of_power.down
actions.aoe+=/rune_of_power,if=buff.rune_of_power.down&((cooldown.touch_of_the_magi.remains>20&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.aoe_totm_max_charges))&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
actions.aoe+=/presence_of_mind,if=buff.deathborne.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=buff.presence_of_mind.max_stack*action.arcane_blast.execute_time
actions.aoe+=/arcane_blast,if=buff.deathborne.up&((talent.resonance.enabled&active_enemies<4)|active_enemies<5)
actions.aoe+=/supernova
actions.aoe+=/arcane_orb,if=buff.arcane_charge.stack=0
actions.aoe+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&talent.amplification.enabled&active_enemies<9
actions.aoe+=/arcane_missiles,if=buff.clearcasting.react&runeforge.arcane_infinity.equipped&active_enemies<6
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack<buff.arcane_charge.max_stack
actions.aoe+=/arcane_explosion,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&prev_gcd.1.arcane_barrage
actions.aoe+=/arcane_barrage,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.aoe+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1

# Prioritize using grisly icicle with ap. Use it with totm otherwise.
actions.cooldowns=frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains>30&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/frost_nova,if=runeforge.grisly_icicle.equipped&cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.cooldowns+=/frostbolt,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_frost.down&(buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down)&cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack<=variable.totm_max_charges&((talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay)|(!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)|cooldown.arcane_power.remains<=gcd))
actions.cooldowns+=/fire_blast,if=runeforge.disciplinary_command.equipped&cooldown.buff_disciplinary_command.ready&buff.disciplinary_command_fire.down&prev_gcd.1.frostbolt
# Always use mirrors with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/mirrors_of_torment,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/mirrors_of_torment,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Always use deathborne with ap. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/deathborne,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/deathborne,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>10&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use spark if totm and ap are on cd and won't be up for longer than the max delay, making sure we have at least two arcane charges and that totm wasn't just used.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains>variable.rs_max_delay&cooldown.arcane_power.remains>variable.rs_max_delay&(talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd|talent.rune_of_power.enabled&cooldown.rune_of_power.remains>variable.rs_max_delay|!talent.rune_of_power.enabled)&buff.arcane_charge.stack>2&debuff.touch_of_the_magi.down
# Use spark with ap when possible. If totm is ready as well, make sure to cast it before totm.
actions.cooldowns+=/radiant_spark,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
actions.cooldowns+=/radiant_spark,if=cooldown.arcane_power.remains=0&((!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack)|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct)
actions.cooldowns+=/touch_of_the_magi,if=cooldown.arcane_power.remains<50&essence.vision_of_perfection.minor
# Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken. Hold a bit to make sure we can RS immediately after totm ends
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8
# Non-Kyrian: Use totm if ap is on cd and won't be up for longer than the max delay. Align with rop if the talent is taken.
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay
actions.cooldowns+=/touch_of_the_magi,if=buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd
# Use ap if totm is on cd and won't be up for longer than the max delay, making sure that we have enough mana and that there is not already a rune of power down.
actions.cooldowns+=/arcane_power,if=(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70))&cooldown.touch_of_the_magi.remains>variable.ap_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
# Use rop if totm is on cd and won't be up for longer than the max delay, making sure there isn't already a rune down and that ap won't become available during rune.
actions.cooldowns+=/rune_of_power,if=buff.rune_of_power.down&cooldown.touch_of_the_magi.remains>variable.rop_max_delay&buff.arcane_charge.stack=buff.arcane_charge.max_stack&(cooldown.arcane_power.remains>15|debuff.touch_of_the_magi.up)
# Kyrian: RS is mana hungry and AB4s are too expensive to use pom to squeeze an extra ab in the totm window. Let's use it to make low charge ABs instant.
actions.cooldowns+=/presence_of_mind,if=buff.arcane_charge.stack=0&covenant.kyrian.enabled
# Non-Kyrian: Use pom to squeeze an extra ab in the totm window.
actions.cooldowns+=/presence_of_mind,if=debuff.touch_of_the_magi.up&!covenant.kyrian.enabled

actions.essences=blood_of_the_enemy,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/blood_of_the_enemy,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains>=50&cooldown.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack<=variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay
actions.essences+=/worldvein_resonance,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/worldvein_resonance,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/guardian_of_azeroth,if=cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack<=variable.totm_max_charges&cooldown.arcane_power.remains<=gcd|fight_remains<cooldown.arcane_power.remains
actions.essences+=/guardian_of_azeroth,if=cooldown.arcane_power.remains=0&(!talent.enlightened.enabled|(talent.enlightened.enabled&mana.pct>=70|variable.am_spam=1))&((cooldown.touch_of_the_magi.remains>variable.ap_max_delay&(buff.arcane_charge.stack=buff.arcane_charge.max_stack|variable.am_spam=1))|(cooldown.touch_of_the_magi.remains=0&buff.arcane_charge.stack=0))&buff.rune_of_power.down&mana.pct>=variable.ap_minimum_mana_pct
actions.essences+=/concentrated_flame,line_cd=6,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/reaping_flames,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&mana.time_to_max>=execute_time
actions.essences+=/focused_azerite_beam,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/purifying_blast,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/ripple_in_space,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/the_unbound_force,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.essences+=/memory_of_lucid_dreams,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down

actions.final_burn=arcane_missiles,if=buff.clearcasting.react,chain=1
actions.final_burn+=/arcane_blast
actions.final_burn+=/arcane_barrage

actions.movement=blink_any,if=movement.distance>=10
actions.movement+=/presence_of_mind
actions.movement+=/arcane_missiles,if=movement.distance<10
actions.movement+=/arcane_orb
actions.movement+=/fire_blast

actions.opener=variable,name=have_opened,op=set,value=1,if=prev_gcd.1.evocation
actions.opener+=/fire_blast,if=runeforge.disciplinary_command.equipped&buff.disciplinary_command_frost.up
actions.opener+=/frost_nova,if=runeforge.grisly_icicle.equipped&mana.pct>95
actions.opener+=/mirrors_of_torment
actions.opener+=/deathborne
actions.opener+=/radiant_spark,if=mana.pct>40
actions.opener+=/cancel_action,if=action.shifting_power.channeling&gcd.remains=0
actions.opener+=/shifting_power,if=soulbind.field_of_blossoms.enabled
actions.opener+=/touch_of_the_magi
actions.opener+=/arcane_power
actions.opener+=/rune_of_power,if=buff.rune_of_power.down
actions.opener+=/presence_of_mind
actions.opener+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.opener+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.opener+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.opener+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.opener+=/arcane_missiles,if=buff.clearcasting.react,chain=1
actions.opener+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges&(cooldown.arcane_power.remains>10|active_enemies<=2)
actions.opener+=/arcane_blast,if=buff.rune_of_power.up|mana.pct>15
actions.opener+=/evocation,if=buff.rune_of_power.down,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.opener+=/arcane_barrage

actions.rotation=variable,name=final_burn,op=set,value=1,if=buff.arcane_charge.stack=buff.arcane_charge.max_stack&!buff.rule_of_threes.up&fight_remains<=((mana%action.arcane_blast.cost)*action.arcane_blast.execute_time)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&covenant.kyrian.enabled&cooldown.radiant_spark.remains<=8)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&talent.rune_of_power.enabled&cooldown.rune_of_power.remains<=gcd&cooldown.arcane_power.remains>variable.totm_max_delay&!covenant.kyrian.enabled)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&!talent.rune_of_power.enabled&cooldown.arcane_power.remains>variable.totm_max_delay)
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(buff.arcane_charge.stack>variable.totm_max_charges&cooldown.arcane_power.remains<=gcd)
actions.rotation+=/strict_sequence,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&buff.arcane_power.down&buff.rune_of_power.down,name=last_spark_stack:arcane_blast:arcane_barrage
actions.rotation+=/arcane_barrage,if=debuff.radiant_spark_vulnerability.stack=debuff.radiant_spark_vulnerability.max_stack&(buff.arcane_power.down|buff.arcane_power.remains<=gcd)&(buff.rune_of_power.down|buff.rune_of_power.remains<=gcd)
actions.rotation+=/arcane_blast,if=dot.radiant_spark.remains>5|debuff.radiant_spark_vulnerability.stack>0
actions.rotation+=/arcane_blast,if=buff.presence_of_mind.up&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=action.arcane_blast.execute_time
actions.rotation+=/arcane_missiles,if=debuff.touch_of_the_magi.up&talent.arcane_echo.enabled&buff.deathborne.down&(debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time|cooldown.presence_of_mind.remains>0|covenant.kyrian.enabled)&(!azerite.arcane_pummeling.enabled|buff.clearcasting_channel.down),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.expanded_potential.up
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&(buff.arcane_power.up|buff.rune_of_power.up|debuff.touch_of_the_magi.remains>action.arcane_missiles.execute_time),chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.stack=buff.clearcasting.max_stack,chain=1
actions.rotation+=/arcane_missiles,if=buff.clearcasting.react&buff.clearcasting.remains<=((buff.clearcasting.stack*action.arcane_missiles.execute_time)+gcd),chain=1
actions.rotation+=/nether_tempest,if=(refreshable|!ticking)&buff.arcane_charge.stack=buff.arcane_charge.max_stack&buff.arcane_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/arcane_orb,if=buff.arcane_charge.stack<=variable.totm_max_charges
actions.rotation+=/supernova,if=mana.pct<=95&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.rotation+=/shifting_power,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&cooldown.evocation.remains>0&cooldown.arcane_power.remains>0&cooldown.touch_of_the_magi.remains>0&(!talent.rune_of_power.enabled|(talent.rune_of_power.enabled&cooldown.rune_of_power.remains>0))
actions.rotation+=/arcane_blast,if=buff.rule_of_threes.up&buff.arcane_charge.stack>3
actions.rotation+=/arcane_barrage,if=mana.pct<variable.barrage_mana_pct&cooldown.evocation.remains>0&buff.arcane_power.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&essence.vision_of_perfection.minor
actions.rotation+=/arcane_barrage,if=cooldown.touch_of_the_magi.remains=0&(cooldown.rune_of_power.remains=0|cooldown.arcane_power.remains=0)&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=mana.pct<=variable.barrage_mana_pct&buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down&buff.arcane_charge.stack=buff.arcane_charge.max_stack&talent.arcane_orb.enabled&cooldown.arcane_orb.remains<=gcd&mana.pct<=90&cooldown.evocation.remains>0
actions.rotation+=/arcane_barrage,if=buff.arcane_power.up&buff.arcane_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.rune_of_power.up&buff.rune_of_power.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_barrage,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.up&debuff.touch_of_the_magi.remains<=gcd&buff.arcane_charge.stack=buff.arcane_charge.max_stack
actions.rotation+=/arcane_blast
actions.rotation+=/evocation,interrupt_if=mana.pct>=85,interrupt_immediate=1
actions.rotation+=/arcane_barrage

actions.shared_cds=use_mana_gem,if=(talent.enlightened.enabled&mana.pct<=80&mana.pct>=65)|(!talent.enlightened.enabled&mana.pct<=85)
actions.shared_cds+=/use_items,if=buff.arcane_power.up
actions.shared_cds+=/potion,if=buff.arcane_power.up
actions.shared_cds+=/time_warp,if=runeforge.temporal_warp.equipped&buff.exhaustion.up
actions.shared_cds+=/lights_judgment,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/bag_of_tricks,if=buff.arcane_power.down&buff.rune_of_power.down&debuff.touch_of_the_magi.down
actions.shared_cds+=/berserking,if=buff.arcane_power.up
actions.shared_cds+=/blood_fury,if=buff.arcane_power.up
actions.shared_cds+=/fireblood,if=buff.arcane_power.up
actions.shared_cds+=/ancestral_call,if=buff.arcane_power.up


# Gear Summary
# gear_ilvl=0.00
# gear_intellect=1800
# gear_crit_rating=500
# gear_haste_rating=500
# gear_mastery_rating=500
# gear_versatility_rating=500

Simulation & Raid Information

Iterations: 1034
Threads: 16
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 300.7 )

Performance:

Total Events Processed: 19892925
Max Event Queue: 295
Sim Seconds: 310883
CPU Seconds: 42.8438
Physical Seconds: 7.6771
Speed Up: 7256

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Execute Count Crit% Avoid% G% B% Interval Combined Duration
Kyrian_Forgelite Kyrian_Forgelite arcane_barrage 44425 1686285 5609 55.29 5107 10197 55.5 277.1 19.3% 0.0% 0.0% 0.0% 5.42sec 1686285 300.66sec
Kyrian_Forgelite Kyrian_Forgelite arcane_echo 342232 187142 622 59.47 527 1053 59.6 298.0 19.3% 0.0% 0.0% 0.0% 4.74sec 187142 300.66sec
Kyrian_Forgelite Kyrian_Forgelite arcane_explosion 1449 2216591 7372 148.55 2498 4990 148.9 744.4 19.3% 0.0% 0.0% 0.0% 1.99sec 2216591 300.66sec
Kyrian_Forgelite Kyrian_Forgelite arcane_orb 153626 0 0 0.00 0 0 12.8 0.0 0.0% 0.0% 0.0% 0.0% 24.11sec 0 300.66sec
Kyrian_Forgelite Kyrian_Forgelite arcane_orb_bolt 153640 418209 1391 12.79 5490 10927 64.1 64.1 19.1% 0.0% 0.0% 0.0% 24.11sec 418209 300.66sec
Kyrian_Forgelite Kyrian_Forgelite arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 131.10sec 0 300.66sec
Kyrian_Forgelite Kyrian_Forgelite berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 262.32sec 0 300.66sec
Kyrian_Forgelite Kyrian_Forgelite conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Kyrian_Forgelite Kyrian_Forgelite deathly_fixation 322253 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 1.80sec 0 300.66sec
Kyrian_Forgelite Kyrian_Forgelite deathly_eruption 322256 20453 68 2.93 1164 2327 14.7 14.7 19.6% 0.0% 0.0% 0.0% 1.80sec 20453 300.66sec
Kyrian_Forgelite Kyrian_Forgelite evocation 12051 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 168.50sec 0 300.66sec
Kyrian_Forgelite Kyrian_Forgelite flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Kyrian_Forgelite Kyrian_Forgelite food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Kyrian_Forgelite Kyrian_Forgelite frostbolt 116 1777 6 0.20 1481 2961 0.0 1.0 20.0% 0.0% 0.0% 0.0% 0.00sec 1777 300.66sec
Kyrian_Forgelite Kyrian_Forgelite mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Kyrian_Forgelite Kyrian_Forgelite_mirror_image frostbolt 59638 5790 145 135.00 54 108 90.0 90.0 19.3% 0.0% 0.0% 0.0% 1.29sec 5790 40.00sec
Kyrian_Forgelite Kyrian_Forgelite potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Kyrian_Forgelite Kyrian_Forgelite radiant_spark 307443 31812 106 1.86 2854 5683 9.3 9.3 19.6% 0.0% 0.0% 0.0% 33.95sec 54663 300.66sec
Kyrian_Forgelite Kyrian_Forgelite radiant_spark ticks -307443 22851 76 12.13 315 632 9.3 60.7 19.4% 0.0% 0.0% 0.0% 33.95sec 54663 300.66sec
Kyrian_Forgelite Kyrian_Forgelite rune_of_power 116011 0 0 0.00 0 0 5.8 0.0 0.0% 0.0% 0.0% 0.0% 52.38sec 0 300.66sec
Kyrian_Forgelite Kyrian_Forgelite touch_of_the_magi 321507 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 54.58sec 0 300.66sec
Kyrian_Forgelite Kyrian_Forgelite touch_of_the_magi_explosion 210833 354950 1181 5.94 11925 0 6.0 29.8 0.0% 0.0% 0.0% 0.0% 54.43sec 354950 300.66sec
Kyrian_Forgelite Kyrian_Forgelite use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.33sec 0 300.66sec
Kyrian_Forgelite Kyrian_Forgelite_bron anima_cannon 332525 0 0 0.00 0 0 7.6 0.0 0.0% 0.0% 0.0% 0.0% 22.55sec 0 57.15sec
Kyrian_Forgelite Kyrian_Forgelite_bron goliath_support 332526 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 12.12sec 0 57.15sec
Kyrian_Forgelite Kyrian_Forgelite_bron melee 0 4129 72 18.27 198 395 17.4 17.4 20.1% 0.0% 0.0% 0.0% 9.07sec 5897 57.15sec
Kyrian_Forgelite Kyrian_Forgelite_bron smash 341163 0 0 0.00 0 0 7.6 0.0 0.0% 0.0% 0.0% 0.0% 22.52sec 0 57.15sec
Kyrian_Pelagos Kyrian_Pelagos arcane_barrage 44425 1705183 5671 55.33 5153 10320 55.5 277.3 19.3% 0.0% 0.0% 0.0% 5.41sec 1705183 300.66sec
Kyrian_Pelagos Kyrian_Pelagos arcane_echo 342232 187385 623 59.50 527 1053 59.6 298.2 19.4% 0.0% 0.0% 0.0% 4.71sec 187385 300.66sec
Kyrian_Pelagos Kyrian_Pelagos arcane_explosion 1449 2250198 7484 148.70 2531 5057 149.0 745.1 19.4% 0.0% 0.0% 0.0% 1.98sec 2250198 300.66sec
Kyrian_Pelagos Kyrian_Pelagos arcane_orb 153626 0 0 0.00 0 0 12.8 0.0 0.0% 0.0% 0.0% 0.0% 24.06sec 0 300.66sec
Kyrian_Pelagos Kyrian_Pelagos arcane_orb_bolt 153640 429069 1427 12.78 5616 11217 64.0 64.0 19.4% 0.0% 0.0% 0.0% 24.07sec 429069 300.66sec
Kyrian_Pelagos Kyrian_Pelagos arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 131.77sec 0 300.66sec
Kyrian_Pelagos Kyrian_Pelagos berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 263.56sec 0 300.66sec
Kyrian_Pelagos Kyrian_Pelagos conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Kyrian_Pelagos Kyrian_Pelagos deathly_fixation 322253 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 1.75sec 0 300.66sec
Kyrian_Pelagos Kyrian_Pelagos deathly_eruption 322256 20504 68 2.94 1164 2327 14.7 14.7 19.5% 0.0% 0.0% 0.0% 1.75sec 20504 300.66sec
Kyrian_Pelagos Kyrian_Pelagos evocation 12051 0 0 0.00 0 0 0.9 0.0 0.0% 0.0% 0.0% 0.0% 167.06sec 0 300.66sec
Kyrian_Pelagos Kyrian_Pelagos flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Kyrian_Pelagos Kyrian_Pelagos food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Kyrian_Pelagos Kyrian_Pelagos frostbolt 116 1779 6 0.20 1481 2961 0.0 1.0 20.1% 0.0% 0.0% 0.0% 0.00sec 1779 300.66sec
Kyrian_Pelagos Kyrian_Pelagos mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Kyrian_Pelagos Kyrian_Pelagos_mirror_image frostbolt 59638 5777 144 135.00 54 108 90.0 90.0 19.0% 0.0% 0.0% 0.0% 1.29sec 5777 40.00sec
Kyrian_Pelagos Kyrian_Pelagos potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Kyrian_Pelagos Kyrian_Pelagos radiant_spark 307443 31828 106 1.86 2857 5665 9.3 9.3 19.6% 0.0% 0.0% 0.0% 33.83sec 54680 300.66sec
Kyrian_Pelagos Kyrian_Pelagos radiant_spark ticks -307443 22852 76 12.14 316 630 9.3 60.7 19.3% 0.0% 0.0% 0.0% 33.83sec 54680 300.66sec
Kyrian_Pelagos Kyrian_Pelagos rune_of_power 116011 0 0 0.00 0 0 5.8 0.0 0.0% 0.0% 0.0% 0.0% 52.37sec 0 300.66sec
Kyrian_Pelagos Kyrian_Pelagos touch_of_the_magi 321507 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 54.47sec 0 300.66sec
Kyrian_Pelagos Kyrian_Pelagos touch_of_the_magi_explosion 210833 364934 1214 5.93 12282 0 6.0 29.7 0.0% 0.0% 0.0% 0.0% 54.30sec 364934 300.66sec
Kyrian_Pelagos Kyrian_Pelagos use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.71sec 0 300.66sec
Necrolord_Emeni Necrolord_Emeni arcane_barrage 44425 1805243 6004 56.72 5339 10603 56.9 284.2 19.3% 0.0% 0.0% 0.0% 5.28sec 1805243 300.66sec
Necrolord_Emeni Necrolord_Emeni arcane_echo 342232 130402 434 36.41 599 1199 36.5 182.4 19.3% 0.0% 0.0% 0.0% 7.76sec 130402 300.66sec
Necrolord_Emeni Necrolord_Emeni arcane_explosion 1449 2434271 8096 153.49 2653 5309 153.8 769.1 19.3% 0.0% 0.0% 0.0% 1.92sec 2434271 300.66sec
Necrolord_Emeni Necrolord_Emeni arcane_orb 153626 0 0 0.00 0 0 13.0 0.0 0.0% 0.0% 0.0% 0.0% 23.74sec 0 300.66sec
Necrolord_Emeni Necrolord_Emeni arcane_orb_bolt 153640 433213 1441 13.00 5589 11152 65.1 65.1 19.1% 0.0% 0.0% 0.0% 23.74sec 433213 300.66sec
Necrolord_Emeni Necrolord_Emeni arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 128.55sec 0 300.66sec
Necrolord_Emeni Necrolord_Emeni berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 257.13sec 0 300.66sec
Necrolord_Emeni Necrolord_Emeni conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Necrolord_Emeni Necrolord_Emeni deathborne 324220 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 257.11sec 0 300.66sec
Necrolord_Emeni Necrolord_Emeni deathly_fixation 322253 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 1.75sec 0 300.66sec
Necrolord_Emeni Necrolord_Emeni deathly_eruption 322256 20467 68 2.94 1164 2327 14.7 14.7 19.6% 0.0% 0.0% 0.0% 1.75sec 20467 300.66sec
Necrolord_Emeni Necrolord_Emeni evocation 12051 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 177.62sec 0 300.66sec
Necrolord_Emeni Necrolord_Emeni flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Necrolord_Emeni Necrolord_Emeni food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Necrolord_Emeni Necrolord_Emeni frostbolt 116 1773 6 0.20 1481 2961 0.0 1.0 19.7% 0.0% 0.0% 0.0% 0.00sec 1773 300.66sec
Necrolord_Emeni Necrolord_Emeni mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Necrolord_Emeni Necrolord_Emeni_mirror_image frostbolt 59638 6517 163 135.00 61 121 90.0 90.0 19.2% 0.0% 0.0% 0.0% 1.29sec 6517 40.00sec
Necrolord_Emeni Necrolord_Emeni potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Necrolord_Emeni Necrolord_Emeni presence_of_mind 205025 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Necrolord_Emeni Necrolord_Emeni rune_of_power 116011 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 50.66sec 0 300.66sec
Necrolord_Emeni Necrolord_Emeni touch_of_the_magi 321507 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 52.63sec 0 300.66sec
Necrolord_Emeni Necrolord_Emeni touch_of_the_magi_explosion 210833 306142 1018 6.11 10005 0 6.1 30.6 0.0% 0.0% 0.0% 0.0% 52.54sec 306142 300.66sec
Necrolord_Emeni Necrolord_Emeni use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.52sec 0 300.66sec
Necrolord_Marileth Necrolord_Marileth arcane_barrage 44425 1727075 5744 56.73 5091 10213 56.9 284.3 19.2% 0.0% 0.0% 0.0% 5.28sec 1727075 300.66sec
Necrolord_Marileth Necrolord_Marileth arcane_echo 342232 121259 403 36.37 558 1113 36.4 182.2 19.4% 0.0% 0.0% 0.0% 7.74sec 121259 300.66sec
Necrolord_Marileth Necrolord_Marileth arcane_explosion 1449 2333804 7762 153.57 2542 5090 153.9 769.5 19.3% 0.0% 0.0% 0.0% 1.92sec 2333804 300.66sec
Necrolord_Marileth Necrolord_Marileth arcane_orb 153626 0 0 0.00 0 0 13.0 0.0 0.0% 0.0% 0.0% 0.0% 23.71sec 0 300.66sec
Necrolord_Marileth Necrolord_Marileth arcane_orb_bolt 153640 414593 1379 12.99 5334 10660 65.1 65.1 19.5% 0.0% 0.0% 0.0% 23.71sec 414593 300.66sec
Necrolord_Marileth Necrolord_Marileth arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 128.50sec 0 300.66sec
Necrolord_Marileth Necrolord_Marileth berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 256.91sec 0 300.66sec
Necrolord_Marileth Necrolord_Marileth conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Necrolord_Marileth Necrolord_Marileth deathborne 324220 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 256.98sec 0 300.66sec
Necrolord_Marileth Necrolord_Marileth deathly_fixation 322253 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 1.77sec 0 300.66sec
Necrolord_Marileth Necrolord_Marileth deathly_eruption 322256 20281 67 2.93 1164 2327 14.7 14.7 18.8% 0.0% 0.0% 0.0% 1.77sec 20281 300.66sec
Necrolord_Marileth Necrolord_Marileth evocation 12051 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 174.71sec 0 300.66sec
Necrolord_Marileth Necrolord_Marileth flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Necrolord_Marileth Necrolord_Marileth food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Necrolord_Marileth Necrolord_Marileth frostbolt 116 1774 6 0.20 1481 2961 0.0 1.0 19.8% 0.0% 0.0% 0.0% 0.00sec 1774 300.66sec
Necrolord_Marileth Necrolord_Marileth mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Necrolord_Marileth Necrolord_Marileth_mirror_image frostbolt 59638 5785 145 135.00 54 108 90.0 90.0 19.2% 0.0% 0.0% 0.0% 1.29sec 5785 40.00sec
Necrolord_Marileth Necrolord_Marileth potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Necrolord_Marileth Necrolord_Marileth presence_of_mind 205025 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Necrolord_Marileth Necrolord_Marileth rune_of_power 116011 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 50.68sec 0 300.66sec
Necrolord_Marileth Necrolord_Marileth touch_of_the_magi 321507 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 52.63sec 0 300.66sec
Necrolord_Marileth Necrolord_Marileth touch_of_the_magi_explosion 210833 284404 946 6.10 9306 0 6.1 30.6 0.0% 0.0% 0.0% 0.0% 52.57sec 284404 300.66sec
Necrolord_Marileth Necrolord_Marileth use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 123.05sec 0 300.66sec
NightFae_Dream NightFae_Dream arcane_barrage 44425 1691411 5626 54.24 5210 10486 54.4 271.8 19.2% 0.0% 0.0% 0.0% 5.54sec 1691411 300.66sec
NightFae_Dream NightFae_Dream arcane_echo 342232 142167 473 41.12 579 1158 41.2 206.1 19.2% 0.0% 0.0% 0.0% 6.95sec 142167 300.66sec
NightFae_Dream NightFae_Dream arcane_explosion 1449 2237133 7441 142.34 2629 5264 142.7 713.3 19.3% 0.0% 0.0% 0.0% 2.08sec 2237133 300.66sec
NightFae_Dream NightFae_Dream arcane_orb 153626 0 0 0.00 0 0 13.4 0.0 0.0% 0.0% 0.0% 0.0% 22.95sec 0 300.66sec
NightFae_Dream NightFae_Dream arcane_orb_bolt 153640 434318 1445 13.39 5422 10821 67.1 67.1 19.4% 0.0% 0.0% 0.0% 22.95sec 434318 300.66sec
NightFae_Dream NightFae_Dream arcane_power 12042 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 97.16sec 0 300.66sec
NightFae_Dream NightFae_Dream berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.71sec 0 300.66sec
NightFae_Dream NightFae_Dream conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
NightFae_Dream NightFae_Dream deathly_fixation 322253 0 0 0.00 0 0 18.8 0.0 0.0% 0.0% 0.0% 0.0% 9.07sec 0 300.66sec
NightFae_Dream NightFae_Dream deathly_eruption 322256 26203 87 3.76 1164 2327 18.8 18.8 19.6% 0.0% 0.0% 0.0% 9.07sec 26203 300.66sec
NightFae_Dream NightFae_Dream evocation 12051 0 0 0.00 0 0 0.3 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
NightFae_Dream NightFae_Dream flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
NightFae_Dream NightFae_Dream food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
NightFae_Dream NightFae_Dream frostbolt 116 1753 6 0.20 1481 2961 0.0 1.0 18.4% 0.0% 0.0% 0.0% 0.00sec 1753 300.66sec
NightFae_Dream NightFae_Dream mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
NightFae_Dream NightFae_Dream_mirror_image frostbolt 59638 5790 145 135.00 54 108 90.0 90.0 19.3% 0.0% 0.0% 0.0% 1.29sec 5790 40.00sec
NightFae_Dream NightFae_Dream potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.40sec 0 300.66sec
NightFae_Dream NightFae_Dream rune_of_power 116011 0 0 0.00 0 0 6.5 0.0 0.0% 0.0% 0.0% 0.0% 47.08sec 0 300.66sec
NightFae_Dream NightFae_Dream shifting_power ticks -314791 197584 659 4.83 1372 2745 6.1 24.1 19.3% 0.0% 0.0% 0.0% 48.42sec 197584 300.66sec
NightFae_Dream NightFae_Dream touch_of_the_magi 321507 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 48.80sec 0 300.66sec
NightFae_Dream NightFae_Dream touch_of_the_magi_explosion 210833 335596 1116 6.59 10176 0 6.6 33.0 0.0% 0.0% 0.0% 0.0% 48.65sec 335596 300.66sec
NightFae_Dream NightFae_Dream use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.74sec 0 300.66sec
NightFae_Dream_SB NightFae_Dream_SB arcane_barrage 44425 1713438 5699 54.26 5295 10522 54.4 271.9 19.3% 0.0% 0.0% 0.0% 5.54sec 1713438 300.66sec
NightFae_Dream_SB NightFae_Dream_SB arcane_echo 342232 144182 480 41.17 586 1171 41.3 206.3 19.3% 0.0% 0.0% 0.0% 6.93sec 144182 300.66sec
NightFae_Dream_SB NightFae_Dream_SB arcane_explosion 1449 2266783 7539 142.36 2663 5331 142.7 713.4 19.3% 0.0% 0.0% 0.0% 2.08sec 2266783 300.66sec
NightFae_Dream_SB NightFae_Dream_SB arcane_orb 153626 0 0 0.00 0 0 13.5 0.0 0.0% 0.0% 0.0% 0.0% 22.88sec 0 300.66sec
NightFae_Dream_SB NightFae_Dream_SB arcane_orb_bolt 153640 442857 1473 13.41 5525 11028 67.2 67.2 19.4% 0.0% 0.0% 0.0% 22.88sec 442857 300.66sec
NightFae_Dream_SB NightFae_Dream_SB arcane_power 12042 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 97.23sec 0 300.66sec
NightFae_Dream_SB NightFae_Dream_SB berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.72sec 0 300.66sec
NightFae_Dream_SB NightFae_Dream_SB conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
NightFae_Dream_SB NightFae_Dream_SB deathly_fixation 322253 0 0 0.00 0 0 18.8 0.0 0.0% 0.0% 0.0% 0.0% 9.26sec 0 300.66sec
NightFae_Dream_SB NightFae_Dream_SB deathly_eruption 322256 26445 88 3.75 1181 2363 18.8 18.8 19.1% 0.0% 0.0% 0.0% 9.26sec 26445 300.66sec
NightFae_Dream_SB NightFae_Dream_SB evocation 12051 0 0 0.00 0 0 0.3 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
NightFae_Dream_SB NightFae_Dream_SB flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
NightFae_Dream_SB NightFae_Dream_SB food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
NightFae_Dream_SB NightFae_Dream_SB frostbolt 116 1822 6 0.20 1520 3040 0.0 1.0 19.8% 0.0% 0.0% 0.0% 0.00sec 1822 300.66sec
NightFae_Dream_SB NightFae_Dream_SB mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
NightFae_Dream_SB NightFae_Dream_SB_mirror_image frostbolt 59638 5867 147 135.00 55 109 90.0 90.0 19.4% 0.0% 0.0% 0.0% 1.29sec 5867 40.00sec
NightFae_Dream_SB NightFae_Dream_SB potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.50sec 0 300.66sec
NightFae_Dream_SB NightFae_Dream_SB rune_of_power 116011 0 0 0.00 0 0 6.5 0.0 0.0% 0.0% 0.0% 0.0% 47.15sec 0 300.66sec
NightFae_Dream_SB NightFae_Dream_SB shifting_power ticks -314791 199902 666 4.83 1389 2779 6.1 24.1 19.2% 0.0% 0.0% 0.0% 48.45sec 199902 300.66sec
NightFae_Dream_SB NightFae_Dream_SB touch_of_the_magi 321507 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 48.85sec 0 300.66sec
NightFae_Dream_SB NightFae_Dream_SB touch_of_the_magi_explosion 210833 338886 1127 6.59 10287 0 6.6 33.0 0.0% 0.0% 0.0% 0.0% 48.68sec 338886 300.66sec
NightFae_Dream_SB NightFae_Dream_SB use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.72sec 0 300.66sec
NightFae_Koraylon NightFae_Koraylon arcane_barrage 44425 1731076 5758 54.24 5321 10710 54.4 271.8 19.5% 0.0% 0.0% 0.0% 5.54sec 1731076 300.66sec
NightFae_Koraylon NightFae_Koraylon arcane_echo 342232 147239 490 41.12 600 1199 41.2 206.1 19.2% 0.0% 0.0% 0.0% 6.96sec 147239 300.66sec
NightFae_Koraylon NightFae_Koraylon arcane_explosion 1449 2304820 7666 142.30 2708 5419 142.6 713.1 19.3% 0.0% 0.0% 0.0% 2.08sec 2304820 300.66sec
NightFae_Koraylon NightFae_Koraylon arcane_orb 153626 0 0 0.00 0 0 13.5 0.0 0.0% 0.0% 0.0% 0.0% 22.94sec 0 300.66sec
NightFae_Koraylon NightFae_Koraylon arcane_orb_bolt 153640 448937 1493 13.41 5600 11185 67.2 67.2 19.4% 0.0% 0.0% 0.0% 22.93sec 448937 300.66sec
NightFae_Koraylon NightFae_Koraylon arcane_power 12042 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 97.22sec 0 300.66sec
NightFae_Koraylon NightFae_Koraylon berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.75sec 0 300.66sec
NightFae_Koraylon NightFae_Koraylon conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
NightFae_Koraylon NightFae_Koraylon deathly_fixation 322253 0 0 0.00 0 0 18.8 0.0 0.0% 0.0% 0.0% 0.0% 9.20sec 0 300.66sec
NightFae_Koraylon NightFae_Koraylon deathly_eruption 322256 28041 93 3.74 1253 2504 18.8 18.8 19.3% 0.0% 0.0% 0.0% 9.20sec 28041 300.66sec
NightFae_Koraylon NightFae_Koraylon evocation 12051 0 0 0.00 0 0 0.3 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
NightFae_Koraylon NightFae_Koraylon flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
NightFae_Koraylon NightFae_Koraylon food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
NightFae_Koraylon NightFae_Koraylon frostbolt 116 1926 6 0.20 1629 3257 0.0 1.0 18.3% 0.0% 0.0% 0.0% 0.00sec 1926 300.66sec
NightFae_Koraylon NightFae_Koraylon mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
NightFae_Koraylon NightFae_Koraylon_mirror_image frostbolt 59638 5800 145 135.00 54 108 90.0 90.0 19.5% 0.0% 0.0% 0.0% 1.29sec 5800 40.00sec
NightFae_Koraylon NightFae_Koraylon potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.51sec 0 300.66sec
NightFae_Koraylon NightFae_Koraylon rune_of_power 116011 0 0 0.00 0 0 6.5 0.0 0.0% 0.0% 0.0% 0.0% 47.14sec 0 300.66sec
NightFae_Koraylon NightFae_Koraylon shifting_power ticks -314791 202243 674 4.83 1405 2809 6.1 24.1 19.3% 0.0% 0.0% 0.0% 48.44sec 202243 300.66sec
NightFae_Koraylon NightFae_Koraylon touch_of_the_magi 321507 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 48.84sec 0 300.66sec
NightFae_Koraylon NightFae_Koraylon touch_of_the_magi_explosion 210833 348081 1158 6.58 10560 0 6.6 33.0 0.0% 0.0% 0.0% 0.0% 48.66sec 348081 300.66sec
NightFae_Koraylon NightFae_Koraylon use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.73sec 0 300.66sec
NightFae_Niya NightFae_Niya arcane_barrage 44425 1720861 5724 54.42 5310 10533 54.6 272.7 19.2% 0.0% 0.0% 0.0% 5.52sec 1720861 300.66sec
NightFae_Niya NightFae_Niya arcane_echo 342232 141990 472 41.14 579 1156 41.2 206.1 19.1% 0.0% 0.0% 0.0% 6.95sec 141990 300.66sec
NightFae_Niya NightFae_Niya arcane_explosion 1449 2292642 7625 142.88 2685 5365 143.2 716.0 19.3% 0.0% 0.0% 0.0% 2.07sec 2292642 300.66sec
NightFae_Niya NightFae_Niya arcane_orb 153626 0 0 0.00 0 0 13.4 0.0 0.0% 0.0% 0.0% 0.0% 23.00sec 0 300.66sec
NightFae_Niya NightFae_Niya arcane_orb_bolt 153640 444977 1480 13.37 5558 11120 67.0 67.0 19.5% 0.0% 0.0% 0.0% 23.00sec 444977 300.66sec
NightFae_Niya NightFae_Niya arcane_power 12042 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 97.12sec 0 300.66sec
NightFae_Niya NightFae_Niya berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 194.65sec 0 300.66sec
NightFae_Niya NightFae_Niya conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
NightFae_Niya NightFae_Niya deathly_fixation 322253 0 0 0.00 0 0 18.8 0.0 0.0% 0.0% 0.0% 0.0% 9.17sec 0 300.66sec
NightFae_Niya NightFae_Niya deathly_eruption 322256 26005 86 3.75 1164 2327 18.8 18.8 19.0% 0.0% 0.0% 0.0% 9.17sec 26005 300.66sec
NightFae_Niya NightFae_Niya evocation 12051 0 0 0.00 0 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
NightFae_Niya NightFae_Niya flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
NightFae_Niya NightFae_Niya food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
NightFae_Niya NightFae_Niya frostbolt 116 1745 6 0.20 1481 2961 0.0 1.0 17.9% 0.0% 0.0% 0.0% 0.00sec 1745 300.66sec
NightFae_Niya NightFae_Niya mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
NightFae_Niya NightFae_Niya_mirror_image frostbolt 59638 5780 145 135.00 54 108 90.0 90.0 19.1% 0.0% 0.0% 0.0% 1.29sec 5780 40.00sec
NightFae_Niya NightFae_Niya potion 307497 0 0 0.00 0 0 1.5 0.0 0.0% 0.0% 0.0% 0.0% 300.38sec 0 300.66sec
NightFae_Niya NightFae_Niya rune_of_power 116011 0 0 0.00 0 0 6.5 0.0 0.0% 0.0% 0.0% 0.0% 47.08sec 0 300.66sec
NightFae_Niya NightFae_Niya shifting_power ticks -314791 197750 659 4.83 1372 2745 6.1 24.1 19.3% 0.0% 0.0% 0.0% 48.40sec 197750 300.66sec
NightFae_Niya NightFae_Niya touch_of_the_magi 321507 0 0 0.00 0 0 6.6 0.0 0.0% 0.0% 0.0% 0.0% 48.80sec 0 300.66sec
NightFae_Niya NightFae_Niya touch_of_the_magi_explosion 210833 342349 1139 6.59 10385 0 6.6 33.0 0.0% 0.0% 0.0% 0.0% 48.63sec 342349 300.66sec
NightFae_Niya NightFae_Niya use_mana_gem 5405 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 120.65sec 0 300.66sec
Venthyr_Nadjia Venthyr_Nadjia arcane_barrage 44425 1712119 5695 57.55 4984 9929 57.8 288.4 19.3% 0.0% 0.0% 0.0% 5.20sec 1712119 300.66sec
Venthyr_Nadjia Venthyr_Nadjia arcane_blast 30451 2 0 0.00 2296 0 0.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 2 300.66sec
Venthyr_Nadjia Venthyr_Nadjia arcane_echo 342232 139190 463 43.69 534 1069 43.8 218.9 19.1% 0.0% 0.0% 0.0% 6.45sec 139190 300.66sec
Venthyr_Nadjia Venthyr_Nadjia arcane_explosion 1449 2324119 7730 156.55 2484 4970 156.9 784.5 19.3% 0.0% 0.0% 0.0% 1.89sec 2324119 300.66sec
Venthyr_Nadjia Venthyr_Nadjia arcane_orb 153626 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.41sec 0 300.66sec
Venthyr_Nadjia Venthyr_Nadjia arcane_orb_bolt 153640 410885 1367 13.16 5233 10452 65.9 65.9 19.1% 0.0% 0.0% 0.0% 23.41sec 410885 300.66sec
Venthyr_Nadjia Venthyr_Nadjia arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 127.36sec 0 300.66sec
Venthyr_Nadjia Venthyr_Nadjia berserking 26297 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 254.60sec 0 300.66sec
Venthyr_Nadjia Venthyr_Nadjia conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Venthyr_Nadjia Venthyr_Nadjia deathly_fixation 322253 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 1.77sec 0 300.66sec
Venthyr_Nadjia Venthyr_Nadjia deathly_eruption 322256 20361 68 2.93 1164 2327 14.7 14.7 19.3% 0.0% 0.0% 0.0% 1.77sec 20361 300.66sec
Venthyr_Nadjia Venthyr_Nadjia evocation 12051 0 0 0.00 0 0 1.1 0.0 0.0% 0.0% 0.0% 0.0% 155.98sec 0 300.66sec
Venthyr_Nadjia Venthyr_Nadjia flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Venthyr_Nadjia Venthyr_Nadjia food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Venthyr_Nadjia Venthyr_Nadjia frostbolt 116 1786 6 0.20 1481 2961 0.0 1.0 20.6% 0.0% 0.0% 0.0% 0.00sec 1786 300.66sec
Venthyr_Nadjia Venthyr_Nadjia mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Venthyr_Nadjia Venthyr_Nadjia_mirror_image frostbolt 59638 5777 144 135.00 54 108 90.0 90.0 19.0% 0.0% 0.0% 0.0% 1.29sec 5777 40.00sec
Venthyr_Nadjia Venthyr_Nadjia mirrors_of_torment 314793 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 129.43sec 0 300.66sec
Venthyr_Nadjia Venthyr_Nadjia agonizing_backlash 320035 20759 69 1.13 3102 6147 5.7 5.7 18.4% 0.0% 0.0% 0.0% 52.75sec 20759 300.66sec
Venthyr_Nadjia Venthyr_Nadjia tormenting_backlash 317589 20938 70 0.55 6406 12793 2.8 2.8 18.5% 0.0% 0.0% 0.0% 131.34sec 20938 300.66sec
Venthyr_Nadjia Venthyr_Nadjia potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Venthyr_Nadjia Venthyr_Nadjia rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 49.91sec 0 300.66sec
Venthyr_Nadjia Venthyr_Nadjia touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 51.76sec 0 300.66sec
Venthyr_Nadjia Venthyr_Nadjia touch_of_the_magi_explosion 210833 310782 1034 6.19 10021 0 6.2 31.0 0.0% 0.0% 0.0% 0.0% 51.62sec 310782 300.66sec
Venthyr_Nadjia Venthyr_Nadjia use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.89sec 0 300.66sec
Venthyr_Theotar Venthyr_Theotar arcane_barrage 44425 1716732 5710 56.93 5044 10109 57.1 285.3 19.3% 0.0% 0.0% 0.0% 5.26sec 1716732 300.66sec
Venthyr_Theotar Venthyr_Theotar arcane_echo 342232 136923 455 43.07 532 1062 43.2 215.8 19.3% 0.0% 0.0% 0.0% 6.52sec 136923 300.66sec
Venthyr_Theotar Venthyr_Theotar arcane_explosion 1449 2326321 7737 153.59 2535 5069 153.9 769.7 19.3% 0.0% 0.0% 0.0% 1.92sec 2326321 300.66sec
Venthyr_Theotar Venthyr_Theotar arcane_orb 153626 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.50sec 0 300.66sec
Venthyr_Theotar Venthyr_Theotar arcane_orb_bolt 153640 419892 1397 13.10 5358 10740 65.7 65.7 19.3% 0.0% 0.0% 0.0% 23.50sec 419892 300.66sec
Venthyr_Theotar Venthyr_Theotar arcane_power 12042 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 129.29sec 0 300.66sec
Venthyr_Theotar Venthyr_Theotar berserking 26297 0 0 0.00 0 0 1.8 0.0 0.0% 0.0% 0.0% 0.0% 258.61sec 0 300.66sec
Venthyr_Theotar Venthyr_Theotar conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Venthyr_Theotar Venthyr_Theotar deathly_fixation 322253 0 0 0.00 0 0 14.7 0.0 0.0% 0.0% 0.0% 0.0% 1.76sec 0 300.66sec
Venthyr_Theotar Venthyr_Theotar deathly_eruption 322256 20374 68 2.93 1164 2327 14.7 14.7 19.1% 0.0% 0.0% 0.0% 1.76sec 20374 300.66sec
Venthyr_Theotar Venthyr_Theotar evocation 12051 0 0 0.00 0 0 0.8 0.0 0.0% 0.0% 0.0% 0.0% 167.79sec 0 300.66sec
Venthyr_Theotar Venthyr_Theotar flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Venthyr_Theotar Venthyr_Theotar food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Venthyr_Theotar Venthyr_Theotar frostbolt 116 1782 6 0.20 1481 2961 0.0 1.0 20.3% 0.0% 0.0% 0.0% 0.00sec 1782 300.66sec
Venthyr_Theotar Venthyr_Theotar mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Venthyr_Theotar Venthyr_Theotar_mirror_image frostbolt 59638 5787 145 135.00 54 108 90.0 90.0 19.2% 0.0% 0.0% 0.0% 1.29sec 5787 40.00sec
Venthyr_Theotar Venthyr_Theotar mirrors_of_torment 314793 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 137.70sec 0 300.66sec
Venthyr_Theotar Venthyr_Theotar agonizing_backlash 320035 19290 64 1.06 3039 6057 5.3 5.3 19.2% 0.0% 0.0% 0.0% 55.01sec 19290 300.66sec
Venthyr_Theotar Venthyr_Theotar tormenting_backlash 317589 19788 66 0.52 6390 12786 2.6 2.6 19.6% 0.0% 0.0% 0.0% 138.98sec 19788 300.66sec
Venthyr_Theotar Venthyr_Theotar potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
Venthyr_Theotar Venthyr_Theotar rune_of_power 116011 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 50.93sec 0 300.66sec
Venthyr_Theotar Venthyr_Theotar touch_of_the_magi 321507 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 52.87sec 0 300.66sec
Venthyr_Theotar Venthyr_Theotar touch_of_the_magi_explosion 210833 317603 1056 6.09 10417 0 6.1 30.5 0.0% 0.0% 0.0% 0.0% 52.78sec 317603 300.66sec
Venthyr_Theotar Venthyr_Theotar use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.66sec 0 300.66sec
arcane arcane arcane_barrage 44425 1702591 5663 57.18 4983 9969 57.4 286.5 19.3% 0.0% 0.0% 0.0% 5.26sec 1702591 300.66sec
arcane arcane arcane_echo 342232 117795 392 37.10 531 1063 37.2 185.9 19.3% 0.0% 0.0% 0.0% 7.65sec 117795 300.66sec
arcane arcane arcane_explosion 1449 2298856 7646 154.68 2487 4974 155.0 775.1 19.3% 0.0% 0.0% 0.0% 1.91sec 2298856 300.66sec
arcane arcane arcane_orb 153626 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 23.64sec 0 300.66sec
arcane arcane arcane_orb_bolt 153640 411987 1370 13.09 5266 10498 65.6 65.6 19.4% 0.0% 0.0% 0.0% 23.64sec 411987 300.66sec
arcane arcane arcane_power 12042 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 128.60sec 0 300.66sec
arcane arcane berserking 26297 0 0 0.00 0 0 1.9 0.0 0.0% 0.0% 0.0% 0.0% 257.11sec 0 300.66sec
arcane arcane conjure_mana_gem 759 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
arcane arcane deathly_fixation 322253 0 0 0.00 0 0 14.4 0.0 0.0% 0.0% 0.0% 0.0% 1.73sec 0 300.66sec
arcane arcane deathly_eruption 322256 20059 67 2.87 1164 2327 14.4 14.4 19.8% 0.0% 0.0% 0.0% 1.73sec 20059 300.66sec
arcane arcane evocation 12051 0 0 0.00 0 0 1.2 0.0 0.0% 0.0% 0.0% 0.0% 172.36sec 0 300.66sec
arcane arcane flask 307185 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
arcane arcane food 308462 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
arcane arcane frostbolt 116 1792 6 0.20 1481 2961 0.0 1.0 21.0% 0.0% 0.0% 0.0% 0.00sec 1792 300.66sec
arcane arcane mirror_image 55342 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
arcane arcane_mirror_image frostbolt 59638 5791 145 135.00 54 108 90.0 90.0 19.3% 0.0% 0.0% 0.0% 1.29sec 5791 40.00sec
arcane arcane potion 307497 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.66sec
arcane arcane rune_of_power 116011 0 0 0.00 0 0 6.1 0.0 0.0% 0.0% 0.0% 0.0% 50.36sec 0 300.66sec
arcane arcane touch_of_the_magi 321507 0 0 0.00 0 0 6.2 0.0 0.0% 0.0% 0.0% 0.0% 52.24sec 0 300.66sec
arcane arcane touch_of_the_magi_explosion 210833 204079 679 6.16 6608 0 6.2 30.9 0.0% 0.0% 0.0% 0.0% 52.13sec 204079 300.66sec
arcane arcane use_mana_gem 5405 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 123.31sec 0 300.66sec

Fluffy_Pillow : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
48321.3 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 38.0sec 8.15% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.3s / 104.5s

Stack Uptimes

  • Health Decade (0 - 10)_1:8.20%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 21.8sec 6.31% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 37.7s

Stack Uptimes

  • Health Decade (10 - 20)_1:6.32%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 24.0sec 7.85% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.5s / 35.8s

Stack Uptimes

  • Health Decade (20 - 30)_1:7.85%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 29.0sec 9.68% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:16.6s / 39.4s

Stack Uptimes

  • Health Decade (30 - 40)_1:9.68%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 33.9sec 11.29% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:22.2s / 46.4s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.29%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 38.5sec 12.91% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:28.1s / 52.1s

Stack Uptimes

  • Health Decade (50 - 60)_1:12.91%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 39.8sec 13.40% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:33.5s / 48.8s

Stack Uptimes

  • Health Decade (60 - 70)_1:13.40%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 43.8sec 14.78% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:34.3s / 55.3s

Stack Uptimes

  • Health Decade (70 - 80)_1:14.78%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 33.6sec 11.31% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:16.3s / 50.7s

Stack Uptimes

  • Health Decade (80 - 90)_1:11.31%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 17.3sec 4.32% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:10.3s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:4.32%
Mirrors of Torment 2.7 0.0 137.1sec 138.3sec 13.2sec 11.87% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_mirrors_of_torment
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.50

Trigger Details

  • interval_min/max:1.3s / 166.0s
  • trigger_min/max:97.1s / 166.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 13.5s

Stack Uptimes

  • mirrors_of_torment_1:5.20%
  • mirrors_of_torment_2:5.32%
  • mirrors_of_torment_3:1.35%

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by $320035s3%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict $320035s1 Shadow damage and their movement and cast speed are slowed by $320035s3%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict $317589s1 Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain $345417s1% mana][]$?c2[your Fire Blast cooldown is reduced by $s2 sec][]$?c3[you gain Brain Freeze][].
  • max_stacks:0
  • duration:25.00
  • cooldown:90.00
  • default_chance:100.00%
Mirrors of Torment 2.9 0.0 128.3sec 129.4sec 13.2sec 12.67% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_mirrors_of_torment
  • max_stacks:3
  • base duration:25.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:true
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:refresh
  • tick_time behavior:unhasted
  • period:1.50

Trigger Details

  • interval_min/max:1.3s / 162.6s
  • trigger_min/max:93.8s / 162.6s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 13.5s

Stack Uptimes

  • mirrors_of_torment_1:5.56%
  • mirrors_of_torment_2:5.67%
  • mirrors_of_torment_3:1.44%

Spelldata

  • id:314793
  • name:Mirrors of Torment
  • tooltip:Attacking, casting a spell or ability, consumes a mirror to inflict Shadow damage and reduce cast and movement speed by $320035s3%. Your final mirror will instead Root and Silence you for {$317589d=4 seconds}.
  • description:Conjure $n mirrors to torment the enemy for {$d=25 seconds}. Whenever the target attacks, casts a spell, or uses an ability, a mirror is consumed to inflict $320035s1 Shadow damage and their movement and cast speed are slowed by $320035s3%. This effect cannot be triggered more often than once per {$345977d=6 seconds}. The final mirror will instead inflict $317589s1 Shadow damage to the enemy, Rooting and Silencing them for {$317589d=4 seconds}. Whenever a mirror is consumed $?c1[you gain $345417s1% mana][]$?c2[your Fire Blast cooldown is reduced by $s2 sec][]$?c3[you gain Brain Freeze][].
  • max_stacks:0
  • duration:25.00
  • cooldown:90.00
  • default_chance:100.00%
Radiant Spark Vulnerability 9.4 27.7 33.2sec 7.9sec 4.8sec 14.89% 0.00% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_radiant_spark_vulnerability
  • max_stacks:4
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.7s / 56.6s
  • trigger_min/max:0.5s / 52.7s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • radiant_spark_vulnerability_1:3.85%
  • radiant_spark_vulnerability_2:3.74%
  • radiant_spark_vulnerability_3:3.54%
  • radiant_spark_vulnerability_4:3.75%

Spelldata

  • id:307454
  • name:Radiant Spark Vulnerability
  • tooltip:Damage taken from $@auracaster increased by $w1%.
  • description:{$@spelldesc307443=Conjure a radiant spark that causes $s1 Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes $307454s1% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells. }
  • max_stacks:4
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Radiant Spark Vulnerability 9.4 27.6 33.2sec 7.9sec 4.8sec 14.93% 0.00% 0.0 (0.0) 0.1

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_radiant_spark_vulnerability
  • max_stacks:4
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.7s / 56.6s
  • trigger_min/max:0.5s / 52.7s
  • trigger_pct:99.99%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • radiant_spark_vulnerability_1:3.89%
  • radiant_spark_vulnerability_2:3.74%
  • radiant_spark_vulnerability_3:3.55%
  • radiant_spark_vulnerability_4:3.75%

Spelldata

  • id:307454
  • name:Radiant Spark Vulnerability
  • tooltip:Damage taken from $@auracaster increased by $w1%.
  • description:{$@spelldesc307443=Conjure a radiant spark that causes $s1 Arcane damage instantly, and an additional $o2 damage over {$d=10 seconds}. The target takes $307454s1% increased damage from your direct damage spells, stacking each time they are struck. This effect ends after {$307454u=4} spells. }
  • max_stacks:4
  • duration:8.00
  • cooldown:0.00
  • default_chance:101.00%
Touch of the Magi 6.2 0.0 52.0sec 52.2sec 7.9sec 16.34% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:arcane
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 67.8s
  • trigger_min/max:46.3s / 67.8s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.34%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.6 0.0 48.7sec 48.8sec 7.9sec 17.39% 0.00% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:NightFae_Niya
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 55.2s
  • trigger_min/max:41.6s / 55.2s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:17.39%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.6 0.0 48.7sec 48.8sec 7.9sec 17.39% 0.00% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:NightFae_Dream_SB
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 56.4s
  • trigger_min/max:40.2s / 56.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:17.39%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.6 0.0 48.7sec 48.8sec 7.9sec 17.38% 0.00% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:NightFae_Dream
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 56.5s
  • trigger_min/max:40.4s / 56.5s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:17.38%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.6 0.0 48.7sec 48.8sec 7.9sec 17.38% 0.00% 0.0 (0.0) 6.4

Buff Details

  • buff initial source:NightFae_Koraylon
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:1.3s / 56.4s
  • trigger_min/max:40.3s / 56.4s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:17.38%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.1 0.0 52.7sec 52.8sec 7.9sec 16.10% 0.00% 0.0 (0.0) 6.0

Buff Details

  • buff initial source:Venthyr_Theotar
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 67.1s
  • trigger_min/max:46.3s / 67.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.10%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.2 0.0 51.5sec 51.7sec 7.9sec 16.40% 0.00% 0.0 (0.0) 6.1

Buff Details

  • buff initial source:Venthyr_Nadjia
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 69.0s
  • trigger_min/max:46.3s / 69.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.40%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.0 0.0 54.2sec 54.4sec 7.9sec 15.69% 0.00% 0.0 (0.0) 5.8

Buff Details

  • buff initial source:Kyrian_Pelagos
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 69.7s
  • trigger_min/max:47.4s / 69.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:15.69%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.0 0.0 54.3sec 54.5sec 7.9sec 15.69% 0.00% 0.0 (0.0) 5.8

Buff Details

  • buff initial source:Kyrian_Forgelite
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 69.7s
  • trigger_min/max:47.4s / 69.7s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:15.69%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.1 0.0 52.5sec 52.6sec 7.9sec 16.16% 0.00% 0.0 (0.0) 6.0

Buff Details

  • buff initial source:Necrolord_Marileth
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 67.3s
  • trigger_min/max:46.3s / 67.3s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.16%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Touch of the Magi 6.1 0.0 52.5sec 52.6sec 7.9sec 16.17% 0.00% 0.0 (0.0) 6.0

Buff Details

  • buff initial source:Necrolord_Emeni
  • cooldown name:buff_touch_of_the_magi
  • max_stacks:1
  • base duration:8.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:2.3s / 68.1s
  • trigger_min/max:46.3s / 68.1s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 8.0s

Stack Uptimes

  • touch_of_the_magi_1:16.17%

Spelldata

  • id:210824
  • name:Touch of the Magi
  • tooltip:Will explode for $w1 Arcane damage upon expiration.
  • description:{$@spelldesc210725=Arcane Blast has a {$h=10}% chance to apply Touch of the Magi, accumulating $s1% of the damage you deal to the target for {$210824d=8 seconds}, and then exploding for that amount of Arcane damage to the target and all nearby enemies.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Statistics & Data Analysis

Fight Length
Fluffy_Pillow Fight Length
Count 1018
Mean 300.66
Minimum 240.09
Maximum 359.94
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
Fluffy_Pillow Damage Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Fluffy_Pillow Priority Target Damage Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Fluffy_Pillow Damage Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Fluffy_Pillow Damage
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Fluffy_Pillow Damage Taken Per Second
Count 1018
Mean 51138.41
Minimum 48958.54
Maximum 53250.26
Spread ( max - min ) 4291.72
Range [ ( max - min ) / 2 * 100% ] 4.20%
Standard Deviation 855.1431
5th Percentile 49825.27
95th Percentile 52540.80
( 95th Percentile - 5th Percentile ) 2715.52
Mean Distribution
Standard Deviation 26.8019
95.00% Confidence Interval ( 51085.88 - 51190.94 )
Normalized 95.00% Confidence Interval ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 11
0.1% Error 1075
0.1 Scale Factor Error with Delta=300 6243
0.05 Scale Factor Error with Delta=300 24971
0.01 Scale Factor Error with Delta=300 624254
HPS
Fluffy_Pillow Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Fluffy_Pillow Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Fluffy_Pillow Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Fluffy_Pillow Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Fluffy_Pillow Theck-Meloree Index
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Fluffy_PillowTheck-Meloree Index (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Fluffy_Pillow Max Spike Value
Count 194
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 18174357 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy2 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
31042.0 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 42.8sec 9.64% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 113.4s

Stack Uptimes

  • Health Decade (0 - 10)_1:9.65%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 24.4sec 6.96% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.9s / 36.2s

Stack Uptimes

  • Health Decade (10 - 20)_1:6.96%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 26.4sec 8.59% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 36.7s

Stack Uptimes

  • Health Decade (20 - 30)_1:8.59%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 32.2sec 10.76% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:22.9s / 42.3s

Stack Uptimes

  • Health Decade (30 - 40)_1:10.76%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 34.5sec 11.56% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.4s / 44.4s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.56%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 35.4sec 11.91% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.7s / 51.3s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.91%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 37.1sec 12.51% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:30.2s / 43.9s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.51%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 40.5sec 13.67% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:30.4s / 48.6s

Stack Uptimes

  • Health Decade (70 - 80)_1:13.67%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 29.7sec 10.02% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:16.3s / 44.3s

Stack Uptimes

  • Health Decade (80 - 90)_1:10.02%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 17.4sec 4.37% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:10.3s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:4.37%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy2
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 1862
death count pct 180.08
avg death time 299.85
min death time 240.09
max death time 358.70
dmg taken 9930622.59

Statistics & Data Analysis

Fight Length
enemy2 Fight Length
Count 1018
Mean 300.66
Minimum 240.09
Maximum 359.94
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
enemy2 Damage Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy2 Priority Target Damage Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy2 Damage Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy2 Damage
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy2 Damage Taken Per Second
Count 1018
Mean 33043.40
Minimum 32038.97
Maximum 34405.40
Spread ( max - min ) 2366.44
Range [ ( max - min ) / 2 * 100% ] 3.58%
Standard Deviation 431.5840
5th Percentile 32357.07
95th Percentile 33751.21
( 95th Percentile - 5th Percentile ) 1394.14
Mean Distribution
Standard Deviation 13.5267
95.00% Confidence Interval ( 33016.89 - 33069.92 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 7
0.1% Error 656
0.1 Scale Factor Error with Delta=300 1591
0.05 Scale Factor Error with Delta=300 6361
0.01 Scale Factor Error with Delta=300 159007
HPS
enemy2 Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy2 Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy2 Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy2 Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy2 Theck-Meloree Index
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy2Theck-Meloree Index (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy2 Max Spike Value
Count 194
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 8282212 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy2"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy3 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
31024.2 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 43.2sec 9.76% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 115.8s

Stack Uptimes

  • Health Decade (0 - 10)_1:9.81%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 24.1sec 6.99% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.7s / 36.2s

Stack Uptimes

  • Health Decade (10 - 20)_1:6.99%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 26.8sec 8.75% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.9s / 35.9s

Stack Uptimes

  • Health Decade (20 - 30)_1:8.75%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 31.9sec 10.68% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:20.7s / 41.7s

Stack Uptimes

  • Health Decade (30 - 40)_1:10.68%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 34.6sec 11.58% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.7s / 45.6s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.58%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 35.1sec 11.82% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:25.3s / 51.3s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.82%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 37.2sec 12.54% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:31.2s / 43.3s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.54%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 40.4sec 13.62% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:30.2s / 48.4s

Stack Uptimes

  • Health Decade (70 - 80)_1:13.62%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 29.4sec 9.92% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:15.9s / 43.7s

Stack Uptimes

  • Health Decade (80 - 90)_1:9.92%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 17.3sec 4.33% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.6s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:4.33%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy3
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 1862
death count pct 180.08
avg death time 299.85
min death time 240.09
max death time 358.70
dmg taken 9933691.35

Statistics & Data Analysis

Fight Length
enemy3 Fight Length
Count 1018
Mean 300.66
Minimum 240.09
Maximum 359.94
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
enemy3 Damage Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy3 Priority Target Damage Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy3 Damage Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy3 Damage
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy3 Damage Taken Per Second
Count 1018
Mean 33054.62
Minimum 31945.92
Maximum 34384.66
Spread ( max - min ) 2438.74
Range [ ( max - min ) / 2 * 100% ] 3.69%
Standard Deviation 433.3178
5th Percentile 32357.57
95th Percentile 33733.05
( 95th Percentile - 5th Percentile ) 1375.48
Mean Distribution
Standard Deviation 13.5810
95.00% Confidence Interval ( 33028.00 - 33081.24 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 7
0.1% Error 661
0.1 Scale Factor Error with Delta=300 1603
0.05 Scale Factor Error with Delta=300 6412
0.01 Scale Factor Error with Delta=300 160287
HPS
enemy3 Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy3 Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy3 Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy3 Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy3 Theck-Meloree Index
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy3Theck-Meloree Index (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy3 Max Spike Value
Count 194
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 10867721 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy3"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy4 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
31086.8 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 44.2sec 9.38% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 118.5s

Stack Uptimes

  • Health Decade (0 - 10)_1:9.40%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 23.7sec 6.68% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 38.4s

Stack Uptimes

  • Health Decade (10 - 20)_1:6.69%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 26.5sec 8.67% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.2s / 36.1s

Stack Uptimes

  • Health Decade (20 - 30)_1:8.67%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 32.3sec 10.80% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.1s / 42.7s

Stack Uptimes

  • Health Decade (30 - 40)_1:10.80%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 34.6sec 11.60% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.9s / 44.0s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.60%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 35.5sec 11.96% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:26.5s / 51.5s

Stack Uptimes

  • Health Decade (50 - 60)_1:11.96%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 37.2sec 12.56% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:30.2s / 42.8s

Stack Uptimes

  • Health Decade (60 - 70)_1:12.56%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 40.8sec 13.76% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:30.2s / 49.1s

Stack Uptimes

  • Health Decade (70 - 80)_1:13.76%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 30.2sec 10.19% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:16.3s / 43.9s

Stack Uptimes

  • Health Decade (80 - 90)_1:10.19%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 17.5sec 4.40% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:10.3s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:4.40%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy4
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 1862
death count pct 180.08
avg death time 299.85
min death time 240.09
max death time 358.70
dmg taken 9930868.11

Statistics & Data Analysis

Fight Length
enemy4 Fight Length
Count 1018
Mean 300.66
Minimum 240.09
Maximum 359.94
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
enemy4 Damage Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy4 Priority Target Damage Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy4 Damage Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy4 Damage
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy4 Damage Taken Per Second
Count 1018
Mean 33045.00
Minimum 31699.79
Maximum 34264.24
Spread ( max - min ) 2564.45
Range [ ( max - min ) / 2 * 100% ] 3.88%
Standard Deviation 433.5176
5th Percentile 32377.11
95th Percentile 33740.61
( 95th Percentile - 5th Percentile ) 1363.50
Mean Distribution
Standard Deviation 13.5873
95.00% Confidence Interval ( 33018.37 - 33071.63 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 7
0.1% Error 662
0.1 Scale Factor Error with Delta=300 1605
0.05 Scale Factor Error with Delta=300 6418
0.01 Scale Factor Error with Delta=300 160435
HPS
enemy4 Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy4 Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy4 Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy4 Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy4 Theck-Meloree Index
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy4Theck-Meloree Index (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy4 Max Spike Value
Count 194
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 11792816 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy4"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

enemy5 : 0 dps, 0 dps to main target

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
31876.6 0.0 Health 0.00% 0.0 100.0% 100%
Talents
  • 15: None
  • 25: None
  • 30: None
  • 35: None
  • 40: None
  • 45: None
  • 50: None
  • Talent Calculator

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Avg Dur Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 43.1sec 9.50% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.0s / 113.9s

Stack Uptimes

  • Health Decade (0 - 10)_1:9.54%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 24.4sec 6.94% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:0.1s / 34.9s

Stack Uptimes

  • Health Decade (10 - 20)_1:6.95%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 27.2sec 8.96% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:2.7s / 36.8s

Stack Uptimes

  • Health Decade (20 - 30)_1:8.96%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 33.2sec 11.12% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:23.7s / 42.9s

Stack Uptimes

  • Health Decade (30 - 40)_1:11.12%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 35.6sec 11.90% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:24.4s / 46.5s

Stack Uptimes

  • Health Decade (40 - 50)_1:11.90%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 36.3sec 12.22% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:27.6s / 52.4s

Stack Uptimes

  • Health Decade (50 - 60)_1:12.22%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 38.6sec 13.02% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:29.0s / 43.8s

Stack Uptimes

  • Health Decade (60 - 70)_1:13.02%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 41.3sec 13.93% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:26.4s / 52.1s

Stack Uptimes

  • Health Decade (70 - 80)_1:13.93%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 24.9sec 8.39% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:13.5s / 40.5s

Stack Uptimes

  • Health Decade (80 - 90)_1:8.39%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 16.4sec 4.02% 0.00% 0.0 (0.0) 0.0

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Trigger Details

  • interval_min/max:0.0s / 0.0s
  • trigger_min/max:0.0s / 0.0s
  • trigger_pct:100.00%
  • duration_min/max:9.5s / 300.0s

Stack Uptimes

  • Health Decade (90 - 100)_1:4.02%
Constant Buffs
Arcane Intellect

Buff Details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff Details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:15.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_bleeding
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00
Chaos Brand

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:101.00%
  • default_value:0.50
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff Details

  • buff initial source:enemy5
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff Details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • base duration:0.00
  • duration modifier:1.00
  • base cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:0.00

Spelldata

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.$?$w2>0[ Magic damage taken reduced by $w2%.][]
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Change Start Gain/s Loss/s Overflow (Total) End (Avg) Min Max

Deaths

death count 1862
death count pct 180.08
avg death time 299.85
min death time 240.09
max death time 358.70
dmg taken 10172189.77

Statistics & Data Analysis

Fight Length
enemy5 Fight Length
Count 1018
Mean 300.66
Minimum 240.09
Maximum 359.94
Spread ( max - min ) 119.85
Range [ ( max - min ) / 2 * 100% ] 19.93%
DPS
enemy5 Damage Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
enemy5 Priority Target Damage Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
enemy5 Damage Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
enemy5 Damage
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
enemy5 Damage Taken Per Second
Count 1018
Mean 33849.78
Minimum 32428.04
Maximum 34998.32
Spread ( max - min ) 2570.28
Range [ ( max - min ) / 2 * 100% ] 3.80%
Standard Deviation 425.1511
5th Percentile 33168.23
95th Percentile 34517.02
( 95th Percentile - 5th Percentile ) 1348.79
Mean Distribution
Standard Deviation 13.3251
95.00% Confidence Interval ( 33823.66 - 33875.90 )
Normalized 95.00% Confidence Interval ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 7
0.1% Error 606
0.1 Scale Factor Error with Delta=300 1544
0.05 Scale Factor Error with Delta=300 6173
0.01 Scale Factor Error with Delta=300 154302
HPS
enemy5 Healing Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
enemy5 Healing Per Second (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
enemy5 Heal
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
enemy5 Healing Taken Per Second
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
enemy5 Theck-Meloree Index
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Interval ( 0.00 - 0.00 )
Normalized 95.00% Confidence Interval ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
enemy5Theck-Meloree Index (Effective)
Count 1018
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
enemy5 Max Spike Value
Count 194
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (63) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 12092332 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 1071 1071 1071
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="enemy5"
source=default
spec=unknown
level=63
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Execute

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Count

Average count of impacts per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

Uptime Average Duration

The average duration of an instance of the tracked uptime.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.